DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G05280 and rnf11a

DIOPT Version :9

Sequence 1:NP_196147.1 Gene:AT5G05280 / 830410 AraportID:AT5G05280 Length:176 Species:Arabidopsis thaliana
Sequence 2:NP_957315.1 Gene:rnf11a / 393996 ZFINID:ZDB-GENE-040426-1277 Length:146 Species:Danio rerio


Alignment Length:85 Identity:29/85 - (34%)
Similarity:39/85 - (45%) Gaps:28/85 - (32%)


- Green bases have known domain annotations that are detailed below.


plant    72 FTPNEDPVDTNANVAKGIKKRALKVIPVDSYSPELKMKATECLICLGDFVEGETVRVLPKCNHGF 136
            |.|..:|.|      |.||                     ||:||:.||..|:.:|.|| |.|.:
Zfish    77 FDPGSEPSD------KKIK---------------------ECVICMMDFEYGDPIRFLP-CMHIY 113

plant   137 HVKCIDTWLLSHSSCPTCRQ 156
            ||.|||.||:...:||:|.:
Zfish   114 HVDCIDAWLMRSFTCPSCME 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G05280NP_196147.1 RING-H2_EL5_like 112..155 CDD:319375 21/42 (50%)
rnf11aNP_957315.1 Vinculin <10..>70 CDD:279395
zf-RING_2 90..131 CDD:290367 21/41 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3018
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.