DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G05280 and RNF11

DIOPT Version :10

Sequence 1:NP_196147.1 Gene:AT5G05280 / 830410 AraportID:AT5G05280 Length:176 Species:Arabidopsis thaliana
Sequence 2:NP_055187.1 Gene:RNF11 / 26994 HGNCID:10056 Length:154 Species:Homo sapiens


Alignment Length:93 Identity:32/93 - (34%)
Similarity:53/93 - (56%) Gaps:12/93 - (12%)


- Green bases have known domain annotations that are detailed below.


plant    73 TPNEDPVDTNANVAKGIK--KR--ALKVIPVDSYSP-----ELKMKATECLICLGDFVEGETVRV 128
            ||::..:.|.....:.|:  :|  .::.:|...|.|     |.|::  ||:||:.|||.|:.:|.
Human    52 TPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIR--ECVICMMDFVYGDPIRF 114

plant   129 LPKCNHGFHVKCIDTWLLSHSSCPTCRQ 156
            || |.|.:|:.|||.||:...:||:|.:
Human   115 LP-CMHIYHLDCIDDWLMRSFTCPSCME 141

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
AT5G05280NP_196147.1 RING-H2_EL5-like 112..155 CDD:438124 21/42 (50%)