powered by:
Protein Alignment AT5G05280 and meu34
DIOPT Version :9
Sequence 1: | NP_196147.1 |
Gene: | AT5G05280 / 830410 |
AraportID: | AT5G05280 |
Length: | 176 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_593329.1 |
Gene: | meu34 / 2543036 |
PomBaseID: | SPAC3A12.03c |
Length: | 309 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 50 |
Identity: | 21/50 - (42%) |
Similarity: | 32/50 - (64%) |
Gaps: | 2/50 - (4%) |
- Green bases have known domain annotations that are detailed below.
plant 113 CLICLGDFVEGETVRVLPKCNHGFHVKCIDTWLLS-HSSCPTCRQSLLEH 161
|:||..|:...:.:|||| |.|.||.:|||||:.: .:|||.|.:...::
pombe 205 CIICYADYAFDDILRVLP-CEHVFHTQCIDTWMTTMKASCPLCNEDYYKY 253
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000414 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X150 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.