DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G05280 and meu34

DIOPT Version :9

Sequence 1:NP_196147.1 Gene:AT5G05280 / 830410 AraportID:AT5G05280 Length:176 Species:Arabidopsis thaliana
Sequence 2:NP_593329.1 Gene:meu34 / 2543036 PomBaseID:SPAC3A12.03c Length:309 Species:Schizosaccharomyces pombe


Alignment Length:50 Identity:21/50 - (42%)
Similarity:32/50 - (64%) Gaps:2/50 - (4%)


- Green bases have known domain annotations that are detailed below.


plant   113 CLICLGDFVEGETVRVLPKCNHGFHVKCIDTWLLS-HSSCPTCRQSLLEH 161
            |:||..|:...:.:|||| |.|.||.:|||||:.: .:|||.|.:...::
pombe   205 CIICYADYAFDDILRVLP-CEHVFHTQCIDTWMTTMKASCPLCNEDYYKY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G05280NP_196147.1 RING-H2_EL5_like 112..155 CDD:319375 20/42 (48%)
meu34NP_593329.1 RING 205..249 CDD:238093 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.