| Sequence 1: | NP_196147.1 | Gene: | AT5G05280 / 830410 | AraportID: | AT5G05280 | Length: | 176 | Species: | Arabidopsis thaliana |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_595926.1 | Gene: | SPBC15C4.06c / 2539787 | PomBaseID: | SPBC15C4.06c | Length: | 556 | Species: | Schizosaccharomyces pombe |
| Alignment Length: | 195 | Identity: | 49/195 - (25%) |
|---|---|---|---|
| Similarity: | 76/195 - (38%) | Gaps: | 48/195 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
plant 18 DANPRTLGDSVSNNKNIASMDTHMVIILAAL-LCALICALGINSVLRCVLRCTRR--FTPNEDPV 79
plant 80 DTNANVAKG-IKKRALKVIPVDSYS-PEL-------------KMKAT------------------ 111
plant 112 -----ECLICLGDFVEGETV-RVLPKCNHGFHVKCIDTWLLSHSS-CPTCRQS---LLEHQTPAN 166
plant 167 166 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AT5G05280 | NP_196147.1 | RING-H2_EL5_like | 112..155 | CDD:319375 | 21/44 (48%) |
| SPBC15C4.06c | NP_595926.1 | zf-RING_2 | 497..541 | CDD:290367 | 21/44 (48%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000414 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.910 | |||||