DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G05280 and Rnf11l1

DIOPT Version :9

Sequence 1:NP_196147.1 Gene:AT5G05280 / 830410 AraportID:AT5G05280 Length:176 Species:Arabidopsis thaliana
Sequence 2:NP_001258153.1 Gene:Rnf11l1 / 100364162 RGDID:2321596 Length:154 Species:Rattus norvegicus


Alignment Length:93 Identity:32/93 - (34%)
Similarity:53/93 - (56%) Gaps:12/93 - (12%)


- Green bases have known domain annotations that are detailed below.


plant    73 TPNEDPVDTNANVAKGIK--KR--ALKVIPVDSYSP-----ELKMKATECLICLGDFVEGETVRV 128
            ||::..:.|.....:.|:  :|  .::.:|...|.|     |.|::  ||:||:.|||.|:.:|.
  Rat    52 TPSQTRLATQLTEEEQIRIAQRIGLIQHLPKGVYDPGRDGSEKKIR--ECVICMMDFVYGDPIRF 114

plant   129 LPKCNHGFHVKCIDTWLLSHSSCPTCRQ 156
            || |.|.:|:.|||.||:...:||:|.:
  Rat   115 LP-CMHIYHLDCIDDWLMRSFTCPSCME 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G05280NP_196147.1 RING-H2_EL5_like 112..155 CDD:319375 21/42 (50%)
Rnf11l1NP_001258153.1 RING-H2_RNF11 98..140 CDD:319382 21/42 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I3009
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000414
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X150
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.