DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT5G04500 and sotv

DIOPT Version :9

Sequence 1:NP_196070.2 Gene:AT5G04500 / 830329 AraportID:AT5G04500 Length:765 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:254 Identity:95/254 - (37%)
Similarity:142/254 - (55%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


plant   518 FTLATMTYDARLWNLKMYVKRYSRCPSVKEIVVIWN--KGPPPDLSELDS-AVPVRIRVQKQNSL 579
            ||...:||| |:.:|.:.:::.:..||::.|:||||  |..||.||...| :.|::||..|:|.|
  Fly   455 FTAVILTYD-RVESLFLLIQKLAVVPSLQSILVIWNNQKKSPPHLSTFPSISKPLKIRQTKENKL 518

plant   580 NNRFEIDPLIKTRAVLELDDD-IMMPCDDIEKGFRVWREHPERLVGFYPR---FVDQTMTYSAEK 640
            :|||...|.|:|.|:|.:||| ||:..|:::.|:.||||.|:.:|||..|   :.:.||.:..| 
  Fly   519 SNRFYPYPEIETEAILTIDDDIIMLTTDELDFGYEVWREFPDHIVGFPSRIHVWENVTMRWHYE- 582

plant   641 FARSHKGYNMILTGAAFMDVRFAFDMYQSDKAKLGRV--FVDEQFNCEDILLNFLYANASGSGKA 703
             :......:|:||||||.. ::...||  ..|..|.:  :|||..|||||.:|||.||.:.:   
  Fly   583 -SEWTNQISMVLTGAAFHH-KYWSHMY--THAMPGDIKDWVDEHMNCEDIAMNFLVANITNN--- 640

plant   704 VEYVRPSLVTIDTSKF------SGVAISGNTNQHYRKRSKCLRRFSDLYGSLVDRRWEF 756
                 |.:......||      :...:|.:.| |.|:||.|:.|||.:||.:..|..||
  Fly   641 -----PPIKVTPRKKFKCPECTNTEMLSADLN-HMRERSACIDRFSKIYGRMPLRTVEF 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT5G04500NP_196070.2 Glyco_transf_64 518..753 CDD:286358 92/249 (37%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069
Glyco_transf_64 455..689 CDD:286358 92/248 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.