DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SAMC1 and sea

DIOPT Version :9

Sequence 1:NP_001190968.1 Gene:SAMC1 / 830101 AraportID:AT4G39460 Length:325 Species:Arabidopsis thaliana
Sequence 2:NP_001027175.1 Gene:sea / 3772221 FlyBaseID:FBgn0037912 Length:317 Species:Drosophila melanogaster


Alignment Length:313 Identity:88/313 - (28%)
Similarity:136/313 - (43%) Gaps:44/313 - (14%)


- Green bases have known domain annotations that are detailed below.


plant    32 INKGFFAS-VNTQEDKPF---------DFFRTLFEGFIAGGTAGVVVETALYPIDTIKTRLQAAR 86
            :::..||| |:....:|:         |..:...:|.:|||..|.:.....||.:.:||:||...
  Fly     1 MDRSAFASLVSPYRRRPWMTEHGAAAADSGQVGLKGIVAGGITGGIEICITYPTEYVKTQLQLDE 65

plant    87 GG----------------GKIVLKGLYSGLAGNIAGVLPASALFVGVYEPTKQKLLKTFPDHLSA 135
            .|                |:....|||.||:..:.|.:|.||...|.:|..|...:.: ...||.
  Fly    66 KGAAKKYNGIFDCVKKTVGERGFLGLYRGLSVLVYGSIPKSAARFGAFEFLKSNAVDS-RGQLSN 129

plant   136 VAHLTAGAIGGLAASLIRV-PTEVVK------QRMQTGQFTSAPSAVRMIASKEGFRGLYAGYRS 193
            ...|..|...|:..:::.| |.|.:|      ||....:|......|..|...||..|:|.|...
  Fly   130 SGKLLCGLGAGVCEAIVAVTPMETIKVKFINDQRSGNPKFRGFAHGVGQIIKSEGISGIYKGLTP 194

plant   194 FLLRDLPFDAIQFCIYEQLCLGYKKAARRELSDPENALIGAFAGALTGAVT----TPLDVIKTRL 254
            .:|:.....||:|.:.|.|...||   ..:.:.|...|:....||:.||.:    |||||:|||:
  Fly   195 TILKQGSNQAIRFFVLESLKDLYK---GDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRM 256

plant   255 MVQG-SAKQYQGIVDCVQTIVREEGAPALLKGIGPRVLWIGIGGSIFFGVLES 306
              || .|.:|:....|...|::.||..|..||..||:..:.:..:|.|.:.:|
  Fly   257 --QGLEASKYKNTAHCAVEILKNEGPAAFYKGTVPRLGRVCLDVAITFMIYDS 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SAMC1NP_001190968.1 PTZ00168 55..304 CDD:185494 81/276 (29%)
seaNP_001027175.1 PTZ00168 34..302 CDD:185494 80/273 (29%)
Mito_carr 34..117 CDD:278578 24/82 (29%)
Mito_carr 125..220 CDD:278578 27/97 (28%)
Mito_carr 235..314 CDD:278578 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.