DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G32790 and sotv

DIOPT Version :9

Sequence 1:NP_001328745.1 Gene:AT4G32790 / 829415 AraportID:AT4G32790 Length:593 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:394 Identity:88/394 - (22%)
Similarity:162/394 - (41%) Gaps:84/394 - (21%)


- Green bases have known domain annotations that are detailed below.


plant   205 HQSRTSHVSLKVKRSSTIDHELLYARTQIENPPLIENDPLLHTPLYWNLSMFKRSYELMEKKLKV 269
            |..|.||         |:..:|.:.:....||...:....::...:..|:::|..::    :|||
  Fly    59 HGKRDSH---------TLILDLEHIQELAVNPEAEQRARNVNCTFWDCLNIYKCEHD----RLKV 110

plant   270 YVYREGKRPVLHKPVLKGI----------YASEGWFMKQLKSSRTFVTKDPRKAHLFYLPFSSKM 324
            |:|          |:.:.:          .:||.:.:.:......:.|.:|.:|.|| || |..:
  Fly   111 YIY----------PLQEFVDEQSDKTATTLSSEYFQILEAVLKSRYYTSNPNEACLF-LP-SLDL 163

plant   325 LEETLYVPGSHSDKNLIQFLKNYLDMISSKYSFWNKTGGSDHFLVACHDWAPSETRQYMAKCIRA 389
            |.:.::      ||:|.......||       ||::  |::|.:   .:..|.....|     ..
  Fly   164 LNQNVF------DKHLAGAALASLD-------FWDR--GANHII---FNMLPGGAPSY-----NT 205

plant   390 LCNSDVSEGFVFGK-----------DVALPETTILVPRRPLRALGGKP----VSQRQILAFFAGG 439
            :.:.:.....:||.           |||:|..:..:.|:...|...:.    |:|..||..|...
  Fly   206 VLDVNTDNAIIFGGGFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQRKFLLVVAQLNILPRFVRT 270

plant   440 MH----GYLRPLLLQNWGGNRDPDMKIFSEIPKSKGKKS--YMEYMKSSKYCICPKGHEVNSPRV 498
            :.    .:...|||.....|.|..|:    .|.|:..||  |...:...|:|:..:...:..|.:
  Fly   271 LRELSLAHSEQLLLLGACENLDLTMR----CPLSQHHKSLEYPRLLSRGKFCLLGRSLRMGQPDL 331

plant   499 VEALFYECVPVIISDNFVPPFFEVLNWESFAVFVLEKDIPDLKNILVSITEERYREMQMRVK-MV 562
            ||.:...|:|||..||:|.||.:|::|...:|.:.|.::..:...|.:|:..:..|||.:|: :.
  Fly   332 VEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIRENELHSVMQKLKAISSVKIVEMQKQVQWLF 396

plant   563 QKHF 566
            .|:|
  Fly   397 SKYF 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G32790NP_001328745.1 Exostosin 263..547 CDD:397245 71/314 (23%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 71/317 (22%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.