DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G28370 and znrf3

DIOPT Version :9

Sequence 1:NP_001328219.1 Gene:AT4G28370 / 828953 AraportID:AT4G28370 Length:562 Species:Arabidopsis thaliana
Sequence 2:NP_001072864.1 Gene:znrf3 / 780325 XenbaseID:XB-GENE-5937936 Length:853 Species:Xenopus tropicalis


Alignment Length:54 Identity:20/54 - (37%)
Similarity:27/54 - (50%) Gaps:5/54 - (9%)


- Green bases have known domain annotations that are detailed below.


plant   507 SRTTDCVICMTA-IDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSL 559
            |.|:||.||:.. ||    ..:..|.||.|.||..|:..|:.....||.||.::
 Frog   261 SSTSDCAICLEKYID----GEELRVIPCTHRFHKRCVDPWLLQNHTCPHCRHNI 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G28370NP_001328219.1 DUF2921 <408..486 CDD:371393
zf-RING_2 510..556 CDD:372655 16/46 (35%)
znrf3NP_001072864.1 ZNRF_3_ecto 74..180 CDD:375639
RING-H2_ZNRF3 266..309 CDD:319713 17/46 (37%)
RING-H2 finger (C3H2C3-type) 266..306 CDD:319713 15/43 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 583..629
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 650..673
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..713
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 834..853
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.