DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G28370 and CG6923

DIOPT Version :10

Sequence 1:NP_194566.3 Gene:AT4G28370 / 828953 AraportID:AT4G28370 Length:562 Species:Arabidopsis thaliana
Sequence 2:NP_001262484.1 Gene:CG6923 / 41420 FlyBaseID:FBgn0037944 Length:1265 Species:Drosophila melanogaster


Alignment Length:85 Identity:24/85 - (28%)
Similarity:37/85 - (43%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


plant   487 VPRQMLPEKYNYHRRFNRDVSRTTDCVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKME 551
            :.|..||.||...||.:........|.||:...::.   ::....||.|.||:.|:.:|:.....
  Fly  1162 IERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIE---NEVRRLPCMHLFHTDCVDQWLVTNKH 1223

plant   552 CPTCR---------RSLPPA 562
            ||.||         .:|||:
  Fly  1224 CPICRVDIETHMPNDALPPS 1243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G28370NP_194566.3 RING-H2_TUL1-like 506..561 CDD:438479 15/63 (24%)
CG6923NP_001262484.1 HRD1 <1155..>1256 CDD:227568 24/85 (28%)
RING-H2_RNF111-like 1185..1230 CDD:438137 14/47 (30%)

Return to query results.
Submit another query.