DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AT4G28370 and RNF149

DIOPT Version :9

Sequence 1:	NP_001328219.1	Gene:	AT4G28370 / 828953	AraportID:	AT4G28370	Length:	562	Species:	Arabidopsis thaliana
Sequence 2:	XP_005263977.1	Gene:	RNF149 / 284996	HGNCID:	23137	Length:	428	Species:	Homo sapiens

Alignment Length:	47	Identity:	13/47 - (27%)
Similarity:	24/47 - (51%)	Gaps:	5/47 - (10%)

- Green bases have known domain annotations that are detailed below.

plant   511 DCVICMTAIDLRQHTSDCM-VTPCEHFFHSGCLQRWMDIKMECPTCR 556
            :|.:|:....::    |.: :.||:|.||..|:..|:.....||.|:
Human   268 NCAVCIENFKVK----DIIRILPCKHIFHRICIDPWLLDHRTCPMCK 310

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AT4G28370	NP_001328219.1	DUF2921	<408..486	CDD:371393
AT4G28370	NP_001328219.1	zf-RING_2	510..556	CDD:372655	12/45 (27%)
RNF149	XP_005263977.1	PA_GRAIL_like	43..185	CDD:239037
		UPF0233	<204..>235	CDD:299753
		zf-RING_2	267..310	CDD:290367	12/45 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910