DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G28370 and RNF149

DIOPT Version :10

Sequence 1:NP_194566.3 Gene:AT4G28370 / 828953 AraportID:AT4G28370 Length:562 Species:Arabidopsis thaliana
Sequence 2:XP_005263977.1 Gene:RNF149 / 284996 HGNCID:23137 Length:428 Species:Homo sapiens


Alignment Length:47 Identity:13/47 - (27%)
Similarity:24/47 - (51%) Gaps:5/47 - (10%)


- Green bases have known domain annotations that are detailed below.


plant   511 DCVICMTAIDLRQHTSDCM-VTPCEHFFHSGCLQRWMDIKMECPTCR 556
            :|.:|:....::    |.: :.||:|.||..|:..|:.....||.|:
Human   268 NCAVCIENFKVK----DIIRILPCKHIFHRICIDPWLLDHRTCPMCK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G28370NP_194566.3 RING-H2_TUL1-like 506..561 CDD:438479 13/47 (28%)
RNF149XP_005263977.1 PA_GRAIL_like 43..185 CDD:239037
RING-H2_RNF149 268..315 CDD:438455 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.