DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G28370 and RNF11

DIOPT Version :10

Sequence 1:NP_194566.3 Gene:AT4G28370 / 828953 AraportID:AT4G28370 Length:562 Species:Arabidopsis thaliana
Sequence 2:NP_055187.1 Gene:RNF11 / 26994 HGNCID:10056 Length:154 Species:Homo sapiens


Alignment Length:61 Identity:19/61 - (31%)
Similarity:28/61 - (45%) Gaps:5/61 - (8%)


- Green bases have known domain annotations that are detailed below.


plant   504 RDVS--RTTDCVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCRRSLPPA 562
            ||.|  :..:|||||  :|. .:.......||.|.:|..|:..|:.....||:|...:..|
Human    89 RDGSEKKIRECVICM--MDF-VYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCMEPVDAA 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G28370NP_194566.3 RING-H2_TUL1-like 506..561 CDD:438479 16/56 (29%)
RNF11NP_055187.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
PPxY motif 37..40
RING-H2_RNF11 98..140 CDD:438131 14/44 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.