DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G28370 and RNF167

DIOPT Version :9

Sequence 1:NP_001328219.1 Gene:AT4G28370 / 828953 AraportID:AT4G28370 Length:562 Species:Arabidopsis thaliana
Sequence 2:NP_001357232.1 Gene:RNF167 / 26001 HGNCID:24544 Length:374 Species:Homo sapiens


Alignment Length:201 Identity:41/201 - (20%)
Similarity:68/201 - (33%) Gaps:53/201 - (26%)


- Green bases have known domain annotations that are detailed below.


plant   395 HNYMQPILL--------LMYSFWIPQIVANVVRDSRKPLHPYYILGMTATRLAIPLYVFGCPHNF 451
            ||.....||        :....|||.:.  :...|.:.|...::....|..|.:|...|      
Human   112 HNVNSNELLNMVWNSEEIQQQIWIPSVF--IGERSSEYLRALFVYEKGARVLLVPDNTF------ 168

plant   452 MRVEPNKVWCICLCTFMGLQAVILLLQHYFGSRCFVPRQMLPEK------------YNYHRRFNR 504
                |...:.|.....:||  ::|.:.....:||...|:.|...            ::|.:..|.
Human   169 ----PLGYYLIPFTGIVGL--LVLAMGAVMIARCIQHRKRLQRNRLTKEQLKQIPTHDYQKALNS 227

plant   505 -----DVSRTTDCVI------------CMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWM-DIKME 551
                 |:...| |:|            |...:|..:......|.||.|.:||.|:..|: ..:..
Human   228 SMFCPDLILPT-CLISSTGFVGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQTRKT 291

plant   552 CPTCRR 557
            ||.|::
Human   292 CPICKQ 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G28370NP_001328219.1 DUF2921 <408..486 CDD:371393 15/77 (19%)
zf-RING_2 510..556 CDD:372655 15/58 (26%)
RNF167NP_001357232.1 PA_C_RZF_like 20..170 CDD:239038 13/69 (19%)
RING-H2_RNF167 252..297 CDD:319711 13/44 (30%)
RING-H2 finger (C3H2C3-type) 254..295 CDD:319711 12/40 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.