DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment AT4G28370 and pja2

DIOPT Version :9

Sequence 1:	NP_001328219.1	Gene:	AT4G28370 / 828953	AraportID:	AT4G28370	Length:	562	Species:	Arabidopsis thaliana
Sequence 2:	XP_004910519.4	Gene:	pja2 / 100379719	XenbaseID:	XB-GENE-966471	Length:	727	Species:	Xenopus tropicalis

Alignment Length:	75	Identity:	21/75 - (28%)
Similarity:	34/75 - (45%)	Gaps:	14/75 - (18%)

- Green bases have known domain annotations that are detailed below.

plant   487 VPRQMLPEKYNYHRRFNRDVSRTTDCVICMTAIDLRQHTSDCMVT--PCEHFFHSGCLQRWMDIK 549
            :|:.::.|.:|.       |.:...|.||.:     ::..|.::|  ||.|.||..|:..|:...
Frog   636 LPQIIIGEDHNI-------VGQEQCCAICCS-----EYIKDEILTELPCHHLFHKPCVTLWLQKS 688

plant   550 MECPTCRRSL 559
            ..||.||..|
Frog   689 GTCPVCRHVL 698

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
AT4G28370	NP_001328219.1	DUF2921	<408..486	CDD:371393
AT4G28370	NP_001328219.1	zf-RING_2	510..556	CDD:372655	14/47 (30%)
pja2	XP_004910519.4	RING-H2_PJA1_2	653..698	CDD:319379	16/49 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910