DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G28370 and rnf128

DIOPT Version :9

Sequence 1:NP_001328219.1 Gene:AT4G28370 / 828953 AraportID:AT4G28370 Length:562 Species:Arabidopsis thaliana
Sequence 2:XP_012824820.2 Gene:rnf128 / 100145171 XenbaseID:XB-GENE-877067 Length:403 Species:Xenopus tropicalis


Alignment Length:45 Identity:13/45 - (28%)
Similarity:21/45 - (46%) Gaps:3/45 - (6%)


- Green bases have known domain annotations that are detailed below.


plant   512 CVICMTAIDLRQHTSDCMVTPCEHFFHSGCLQRWMDIKMECPTCR 556
            |.:|   |:..:.:....:..|.||||..|:..|:.....||.|:
 Frog   258 CAVC---IEPYKPSDVVRILTCNHFFHKNCIDPWLLEHRTCPMCK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G28370NP_001328219.1 DUF2921 <408..486 CDD:371393
zf-RING_2 510..556 CDD:372655 12/43 (28%)
rnf128XP_012824820.2 PA_GRAIL_like 38..174 CDD:239037
COG5540 <208..302 CDD:227827 13/45 (29%)
RING-H2_RNF128_like 256..304 CDD:319716 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.