DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACBP2 and anox

DIOPT Version :9

Sequence 1:NP_194507.1 Gene:ACBP2 / 828891 AraportID:AT4G27780 Length:354 Species:Arabidopsis thaliana
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:257 Identity:75/257 - (29%)
Similarity:115/257 - (44%) Gaps:37/257 - (14%)


- Green bases have known domain annotations that are detailed below.


plant    90 SEEDDDWEGVESTELDEAFSAATLFVTTAAADRLSQKVPSDVQQQLYGLYKIATEGPCTAPQPSA 154
            |:.|.|       .:||.|..||..|.     :.|..:.|......||.||.||.|||....|..
  Fly     2 SDSDTD-------TVDELFHLATEHVA-----KQSNSIGSADLLIFYGYYKQATNGPCKEQSPGL 54

plant   155 LKMTARAKWQAWQKLGAMPPEEAMEKYIEIVTQLYPTWLDGGVKAGSRGGDDAASNSRGTMGPVF 219
            |::.|::|||||:.||.|....|.:.|::.:.:|.|.|                 .||...|.|.
  Fly    55 LQLQAKSKWQAWRNLGTMSQSAARQAYVQKLQELQPNW-----------------RSRRNPGWVV 102

plant   220 SSL----VYDEESENELKIDAIHGFAREGEVENLLKSIESGIPVNARDSEGRTPLHWAIDRGHLN 280
            .|:    :.|:..::|   ..:....:|..::.|.:.::....|.. |..|...:|||.||..:.
  Fly   103 HSIESVPLEDQRLDSE---KTLFDHVKENNLDRLRELLQPSDLVKL-DEHGMALIHWATDRNAVE 163

plant   281 IAKVLVDKNADVNAKDNEGQTPLHYAVVCDREAIAEFLVKQNANTAAKDEDGNSPLDLCESD 342
            |.:.||...|.||.:|.|.|||||||..|......:.|::.:|:...:|.||.:..|:.:.:
  Fly   164 IIQFLVRSGASVNQRDAEQQTPLHYAASCGHLEALQCLLELHASLELRDSDGQTCYDVADDE 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACBP2NP_194507.1 ACBP 105..190 CDD:376410 31/84 (37%)
ANK repeat 236..263 CDD:293786 3/26 (12%)
Ank_2 241..329 CDD:372319 28/87 (32%)
ANK repeat 265..296 CDD:293786 12/30 (40%)
ANK repeat 298..329 CDD:293786 11/30 (37%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 31/84 (37%)
ANK 125..231 CDD:238125 32/102 (31%)
Ank_2 125..212 CDD:289560 28/87 (32%)
ANK repeat 148..179 CDD:293786 12/30 (40%)
ANK repeat 181..212 CDD:293786 11/30 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 60 1.000 Domainoid score I3848
eggNOG 1 0.900 - - E1_COG4281
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H12465
Inparanoid 1 1.050 113 1.000 Inparanoid score I2047
OMA 1 1.010 - - QHG54934
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005754
OrthoInspector 1 1.000 - - otm3542
orthoMCL 1 0.900 - - OOG6_104190
Panther 1 1.100 - - O PTHR24119
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1917
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.