DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK4 and rl

DIOPT Version :9

Sequence 1:NP_192046.1 Gene:MPK4 / 828151 AraportID:AT4G01370 Length:376 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:368 Identity:179/368 - (48%)
Similarity:242/368 - (65%) Gaps:8/368 - (2%)


- Green bases have known domain annotations that are detailed below.


plant     7 FGSSGDQSSSKGVATHGGSYVQYNVYGNLFEVSRKYVPPLRPIGRGAYGIVCAATNSETGEEVAI 71
            |.|||...:..|......|..:. :.|.:|||..:|: .|..||.||||:|.:|.::.|.:.|||
  Fly     4 FNSSGSVVNGTGSTEVPQSNAEV-IRGQIFEVGPRYI-KLAYIGEGAYGMVVSADDTLTNQRVAI 66

plant    72 KKIGNAFDNIIDAKRTLREIKLLKHMDHENVIAVKDIIKPPQRENFNDVYIVYELMDTDLHQIIR 136
            ||| :.|::....:||||||.:|....|||:|.::||::....:...|||||..||:|||:::::
  Fly    67 KKI-SPFEHQTYCQRTLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK 130

plant   137 SNQPLTDDHCRFFLYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKLGDFGLAR----TKSET 197
            : |.|::||..:||||:||||||:||||||||||||||||||..||||:.||||||    ....|
  Fly   131 T-QRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHT 194

plant   198 DFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGETMTREPLFPGKDYVHQLRLITELIGS 262
            .|:||||.||||||||::||...||.:||||||||||.|.::..|:||||.|:.||..|..::||
  Fly   195 GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGS 259

plant   263 PDDSSLGFLRSDNARRYVRQLPQYPRQNFAARFPNMSAGAVDLLEKMLVFDPSRRITVDEALCHP 327
            |....|..:.::.||.|:..||..|...:|..|||..|.|:|||.|||.|:|.:||.|:|||.||
  Fly   260 PSRDDLECIINEKARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHP 324

plant   328 YLAPLHDINEEPVCVRPFNFDFEQPTLTEENIKELIYRETVKF 370
            ||...:|..:|||...||..:.|...::.:.:|.||:.||:||
  Fly   325 YLEQYYDPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK4NP_192046.1 STKc_TEY_MAPK 36..372 CDD:143363 172/339 (51%)
S_TKc 46..329 CDD:214567 152/286 (53%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 170/336 (51%)
S_TKc 38..326 CDD:214567 153/290 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I618
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 1 1.000 - - otm2432
orthoMCL 1 0.900 - - OOG6_100339
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X259
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.