DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and Lrp4

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:NP_112612.2 Gene:Lrp4 / 83469 RGDID:619731 Length:1905 Species:Rattus norvegicus


Alignment Length:414 Identity:91/414 - (21%)
Similarity:134/414 - (32%) Gaps:154/414 - (37%)


- Green bases have known domain annotations that are detailed below.


plant   193 LW-TNSNDECGARCDEQMDF----VKNFKGHAQILEKGGYTAFTPHYITWF-------------- 238
            || .:.:::||...|||.|.    .|.|:     ...|  :....|   |:              
  Rat   126 LWHCDGDNDCGDNSDEQCDMRKCSDKEFR-----CSDG--SCIAEH---WYCDGDTDCKDGSDEE 180

plant   239 -CPFQFINSPHC---KSQCINHGR------YCAPDPEDNFREGYEGKDVVLENLRQLCVHRVANE 293
             || ..:.||.|   :.||. :||      :|  |.:|:..:                       
  Rat   181 SCP-SAVPSPPCNLEEFQCA-YGRRILDIYHC--DGDDDCGD----------------------- 218

plant   294 SSRPWVWWDYVTDFHSRCSMKEKKYSIDCAESYESLRLFSDLPIEKIKKCIGDPEADTENQVLRT 358
                   |...:|..|....:..::..|           |.|.:....:|.||.:.|        
  Rat   219 -------WSDESDCSSHQPCRSGEFMCD-----------SGLCVNAGWRCDGDADCD-------- 257

plant   359 EQVSQIGRGNRGDVTILPTLVINNAQYRGRLERTAVLKAICAGFN---ETSEPAICLNTGLETNE 420
                     ::.|.....|.:....|:|.|..|...|...|.|.:   :.|:...|.|||  :.:
  Rat   258 ---------DQSDERNCTTSMCTAEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTG--SPQ 311

plant   421 CLENNGGCWQDTKANITACQDTFRGR------LCECPVVKGVQYKGDG-----YTSCTP-YGPAR 473
            |..:...||              .||      ||     .||...||.     ..:|.| .|...
  Rat   312 CASDQFLCW--------------NGRCIGQRKLC-----NGVNDCGDNSDESPQQNCRPRTGEEN 357

plant   474 CTMNNGGCWSDTR--NGLTFSACSDSVSTGCKCPEGFQ--GDGLTCEDINECKERSVCQCSGCRC 534
            |.:|||||....:  .|          :..|.|..|::  .||.||:|:|||.|...|...   |
  Rat   358 CNVNNGGCAQKCQMIRG----------AVQCTCHTGYRLTEDGRTCQDVNECAEEGYCSQG---C 409

plant   535 KNSWGGYKCSCSGDRLYINDQDTC 558
            .||.|.::|.|........|:.:|
  Rat   410 TNSEGAFQCWCEAGYELRPDRRSC 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040
VESA1_N <494..>564 CDD:289551 21/67 (31%)
EGF_CA 517..>545 CDD:238011 11/27 (41%)
Lrp4NP_112612.2 LDLa 27..66 CDD:238060
Ldl_recept_a 70..105 CDD:278486
LDLa 110..142 CDD:238060 5/15 (33%)
LDLa 148..182 CDD:238060 5/43 (12%)
LDLa 231..265 CDD:238060 8/61 (13%)
LDLa 270..304 CDD:238060 8/33 (24%)
LDLa 311..343 CDD:197566 11/50 (22%)
FXa_inhibition 358..393 CDD:291342 12/44 (27%)
EGF_CA 395..434 CDD:214542 14/42 (33%)
NHL <471..622 CDD:302697
NHL repeat 471..507 CDD:271320
LDL-receptor class B 1 480..522
LY 505..545 CDD:214531
NHL repeat 510..550 CDD:271320
LDL-receptor class B 2 523..565
NHL repeat 555..589 CDD:271320
LDL-receptor class B 3 566..609
LY 590..632 CDD:214531
NHL repeat 598..622 CDD:271320
LDL-receptor class B 4 610..652
LY 633..673 CDD:214531
LDL-receptor class B 5 653..693
FXa_inhibition 702..>729 CDD:291342
LY 766..806 CDD:214531
LDL-receptor class B 6 785..827
LY 808..850 CDD:214531
LDL-receptor class B 7 828..870
LDL-receptor class B 8 871..914
Ldl_recept_b 871..911 CDD:278487
LY 895..937 CDD:214531
LDL-receptor class B 9 915..956
LY 938..979 CDD:214531
LDL-receptor class B 10 957..998
FXa_inhibition 1006..1043 CDD:291342
NHL <1085..1277 CDD:302697
NHL repeat 1085..1123 CDD:271320
LDL-receptor class B 11 1093..1135
NHL repeat 1128..1161 CDD:271320
LDL-receptor class B 12 1136..1178
NHL repeat 1166..1203 CDD:271320
LDL-receptor class B 13 1179..1222
NHL repeat 1212..1244 CDD:271320
LDL-receptor class B 14 1223..1263
NHL repeat 1253..1277 CDD:271320
LDL-receptor class B 15 1264..1306
FXa_inhibition 1313..1348 CDD:291342
LY 1379..1418 CDD:214531
LDL-receptor class B 16 1397..1439
LY 1420..1460 CDD:214531
LDL-receptor class B 17 1440..1482
LDL-receptor class B 18 1483..1526
Ldl_recept_b 1483..1523 CDD:278487
LY 1507..1547 CDD:214531
LDL-receptor class B 19 1527..1568
LY 1549..1589 CDD:214531
LDL-receptor class B 20 1569..1610
FXa_inhibition 1617..>1641 CDD:291342
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1659..1696
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1853..1905
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.