DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and Rnf145

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:NP_001350095.1 Gene:Rnf145 / 74315 MGIID:1921565 Length:663 Species:Mus musculus


Alignment Length:138 Identity:36/138 - (26%)
Similarity:47/138 - (34%) Gaps:45/138 - (32%)


- Green bases have known domain annotations that are detailed below.


plant   370 GDVTILPTLVI-----NNAQYRGR-------LERTAVLKAICAGFNETSEPAICLNTGLETNECL 422
            |:.|::.:::|     .|...|.:       |.|.||.|.       .|.|       :.|.|.|
Mouse   480 GEWTVMGSMIIFIHSYYNVWLRAQLGWKSFLLRRDAVNKI-------KSLP-------VATQEQL 530

plant   423 ENNGG----CWQDTK-ANITACQDTFRG-------------RLCECPVVKGVQYKGDGYTSCTPY 469
            |.:..    |:||.| |.||.|...|..             .||.|.:....|..|.| |...|.
Mouse   531 EKHNDICAICYQDMKSAVITPCSHFFHAGCLKKWLYVQDTCPLCHCHLKNSSQLPGLG-TEAAPQ 594

plant   470 GPARCTMN 477
            .||....|
Mouse   595 PPAGAEQN 602

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040
VESA1_N <494..>564 CDD:289551
EGF_CA 517..>545 CDD:238011
Rnf145NP_001350095.1 TRC8_N 8..506 CDD:372682 5/25 (20%)
YLYF motif. /evidence=ECO:0000269|PubMed:29374057 81..84
HRD1 <520..627 CDD:227568 26/91 (29%)
RING-H2_RNF145 533..575 CDD:319598 10/41 (24%)
RING-H2 finger (C3H2C3-type) 537..574 CDD:319598 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 587..663 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.