DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment VSR7 and Rnf148

DIOPT Version :9

Sequence 1:	NP_001190777.1	Gene:	VSR7 / 827757	AraportID:	AT4G20110	Length:	628	Species:	Arabidopsis thaliana
Sequence 2:	NP_082030.1	Gene:	Rnf148 / 71300	MGIID:	1918550	Length:	316	Species:	Mus musculus

Alignment Length:	57	Identity:	18/57 - (31%)
Similarity:	28/57 - (49%)	Gaps:	1/57 - (1%)

- Green bases have known domain annotations that are detailed below.

plant    65 GSVVYPDS-KTDGCSAFGKTFKPKFPRPTILLLDRGGCYFALKAWHAQQAGAAAVLV 120
            |:||.|:. ..:.||......:|......:.|::||||.|..|...|.:.||..|::
Mouse    86 GAVVLPEGWNQNACSPLTNFSRPDQTDTWLALIERGGCTFTHKINLAAEKGANGVII 142

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
VSR7	NP_001190777.1	PA_VSR	53..176	CDD:239040	18/57 (32%)
		VESA1_N	<494..>564	CDD:289551
		EGF_CA	517..>545	CDD:238011
Rnf148	NP_082030.1	PA_GRAIL_like	56..190	CDD:239037	18/57 (32%)
Rnf148	NP_082030.1	zf-RING_2	267..310	CDD:290367
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910