DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and Rnf148

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:NP_001178011.1 Gene:Rnf148 / 681407 RGDID:1595417 Length:316 Species:Rattus norvegicus


Alignment Length:289 Identity:54/289 - (18%)
Similarity:92/289 - (31%) Gaps:106/289 - (36%)


- Green bases have known domain annotations that are detailed below.


plant    65 GSVVYPDS-KTDGCSAFGKTFKPKFPRPTILLLDRGGCYFALKAWHAQQAGAAAVLV-----ADN 123
            |:||.|:. ..:.||......:|......:.|::||||.|..|...|.:.||..|::     ..|
  Rat    86 GAVVLPEGWNQNACSPLTNFSRPDQADSWLALIERGGCTFTHKINVAAEKGANGVIIYNYPGTGN 150

plant   124 VDEPLLTMDSPEESKDADGFIEKLTIPSVLIDKSFGDDLRQGFQKGKNIVIKLD----------- 177
            ...|:    |.:.:::         |.:|:|....|.:|....|:|..:.|.::           
  Rat   151 KVFPM----SHQGTEN---------IVAVMIGNLKGMELLHLIQQGVYVTIIIEVGRMHMPWLSH 202

plant   178 ---------------------WRESVPHPDKRVEYELWTNSNDECGARCDEQMDFVKNFKGHAQI 221
                                 ||...|:...|.:.::.::               ||...|..|:
  Rat   203 YVMSLFTFLAATVAYLFLYCAWRPRAPNSSTRRQRQIKSD---------------VKKAIGQLQL 252

plant   222 -LEKGGYTAFTPHYITWFCPFQFINSPHCKSQCINHGRYCAPDPEDNFREGYEGKDVVLENLRQL 285
             :.|.|.....|:                :..|:    .|.        :.|:.:||:    |.|
  Rat   253 RVLKEGDKELDPN----------------EDSCV----VCF--------DIYKAQDVI----RIL 285

plant   286 -CVHRVANESSRPWVWWDYVTDFHSRCSM 313
             |.|........||:.      .|..|.|
  Rat   286 TCKHFFHKTCIDPWLL------AHRTCPM 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040 29/116 (25%)
VESA1_N <494..>564 CDD:289551
EGF_CA 517..>545 CDD:238011
Rnf148NP_001178011.1 PA_GRAIL_like 56..190 CDD:239037 29/116 (25%)
zf-RING_2 267..310 CDD:290367 14/64 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.