DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and PJA1

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:NP_001369704.1 Gene:PJA1 / 64219 HGNCID:16648 Length:643 Species:Homo sapiens


Alignment Length:120 Identity:26/120 - (21%)
Similarity:43/120 - (35%) Gaps:23/120 - (19%)


- Green bases have known domain annotations that are detailed below.


plant   122 DNVDEPLLTMDSPEESKDADGFIEKLTIPSVLIDKSFGDDLRQGFQKGKNIVIKLDWRESVPHPD 186
            |:.|.|..|....:.:.|.:|..:.|.      .:..|:. ..|:.:.|....|.:.|.....|:
Human   279 DDDDMPHSTSRWRDTANDNEGHSDGLA------RRGRGES-SSGYPEPKYPEDKREARSDQVKPE 336

plant   187 K-------RVEYELWTNSNDECGARCDEQMDFVK--------NFKGHAQILEKGG 226
            |       ..:.:.||:| |:....|||..|..|        .::...|.|...|
Human   337 KVPRRRRTMADPDFWTHS-DDYYKYCDEDSDSDKEWIAALRRKYRSREQTLSSSG 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040 10/53 (19%)
VESA1_N <494..>564 CDD:289551
EGF_CA 517..>545 CDD:238011
PJA1NP_001369704.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..363 19/91 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..454 3/11 (27%)
RING-H2_PJA1_2 594..639 CDD:319379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.