| Sequence 1: | NP_001190777.1 | Gene: | VSR7 / 827757 | AraportID: | AT4G20110 | Length: | 628 | Species: | Arabidopsis thaliana |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_476441.2 | Gene: | Gas6 / 58935 | RGDID: | 61913 | Length: | 674 | Species: | Rattus norvegicus |
| Alignment Length: | 210 | Identity: | 55/210 - (26%) |
|---|---|---|---|
| Similarity: | 71/210 - (33%) | Gaps: | 68/210 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
plant 386 RGRLERTAVLKAICA----------------------------GFNETSEP--AIC---LNTGLE 417
plant 418 TNECLENNGGCWQDTKAN-ITACQDTFRGRLCECPVVKGVQYKGDGYTSCTPYGPARCTMNNGGC 481
plant 482 WSDTRNGLTFSACSDSV-STGCKCPEGF--QGDGLTCEDINECKERSVCQCSGCRCKNSWGGYKC 543
plant 544 SCSGDRLYINDQDTC 558 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| VSR7 | NP_001190777.1 | PA_VSR | 53..176 | CDD:239040 | |
| VESA1_N | <494..>564 | CDD:289551 | 25/68 (37%) | ||
| EGF_CA | 517..>545 | CDD:238011 | 12/27 (44%) | ||
| Gas6 | NP_476441.2 | GLA | 26..90 | CDD:214503 | 6/35 (17%) |
| EGF_CA | 115..150 | CDD:238011 | 9/34 (26%) | ||
| FXa_inhibition | 157..192 | CDD:291342 | 13/43 (30%) | ||
| EGF_CA | 194..225 | CDD:214542 | 13/32 (41%) | ||
| cEGF | 215..238 | CDD:289433 | 6/19 (32%) | ||
| FXa_inhibition | 244..274 | CDD:291342 | |||
| LamG | 295..447 | CDD:238058 | |||
| Laminin_G_2 | 510..647 | CDD:280389 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||