DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and RNF150

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:XP_005263207.1 Gene:RNF150 / 57484 HGNCID:23138 Length:460 Species:Homo sapiens


Alignment Length:275 Identity:44/275 - (16%)
Similarity:84/275 - (30%) Gaps:115/275 - (41%)


- Green bases have known domain annotations that are detailed below.


plant   347 PEADTENQV---------LRTEQVSQIGRGNRGD--VTILPTLVINNAQYRGRLERTAVLKAICA 400
            |:.|...:|         |..:..::.....||.  :.::|.   .|..||.::..         
Human    82 PKQDARGEVVMASSAHDRLACDPNTKFAAPTRGKNWIALIPK---GNCTYRDKIRN--------- 134

plant   401 GFNETSEPAICLNTGLETNECLENNGGCWQDTKANITACQDTFRGRLCECPVVKGVQYKGDGYTS 465
            .|.:.:...:..|.|..|||.:                                           
Human   135 AFLQNASAVVIFNVGSNTNETI------------------------------------------- 156

plant   466 CTPYGPARCTMNNGGCWSDTRNGL-TFSACSDSVSTGCKC--------PEGFQGDGLTCEDINEC 521
                     ||.:.|..|.....| ..|.|..|:|:|.:.        |:|        ::|...
Human   157 ---------TMPHAGLMSSHAQPLKLISPCPYSLSSGVEDIVAIMIPEPKG--------KEIVSL 204

plant   522 KERSVCQCSGCRCKNSWGGYKCSCSGDRLYINDQDTCIERYGSKTA---WWLTFLILAIVAVAGL 583
            .||::..                    .:||......:::|.|:|:   ..::|::|.|:::|.|
Human   205 LERNITV--------------------TMYITIGTRNLQKYVSRTSVVFVSISFIVLMIISLAWL 249

plant   584 AGYIFYKYRFRSYMD 598
            ..|...::|:.:..|
Human   250 VFYYIQRFRYANARD 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040
VESA1_N <494..>564 CDD:289551 12/77 (16%)
EGF_CA 517..>545 CDD:238011 3/27 (11%)
RNF150XP_005263207.1 PA_GRAIL_like 45..215 CDD:239037 31/224 (14%)
UPF0233 <229..>254 CDD:299753 7/24 (29%)
zf-RING_2 298..341 CDD:290367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.