powered by:
Protein Alignment VSR7 and Rnf133
DIOPT Version :9
Sequence 1: | NP_001190777.1 |
Gene: | VSR7 / 827757 |
AraportID: | AT4G20110 |
Length: | 628 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_937894.1 |
Gene: | Rnf133 / 386611 |
MGIID: | 2677436 |
Length: | 339 |
Species: | Mus musculus |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 32/73 - (43%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
plant 49 GSIANFGLPDYGGFLIGSVVYPDSKTDGCSAFGKTF-KPKFPRPTILLLDRGGCYFALKAWHAQQ 112
|....||.......:.|.||.|:.|.........|| .|:...|.|.|::||||.|..|...|.:
Mouse 57 GETGVFGRSSILKRVAGVVVPPEGKIQNACDPNTTFILPRNKEPWIALIERGGCAFTQKIKVASE 121
plant 113 AGAAAVLV 120
.||..|::
Mouse 122 HGARGVII 129
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.