DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and Amfr

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:NP_035917.2 Gene:Amfr / 23802 MGIID:1345634 Length:639 Species:Mus musculus


Alignment Length:131 Identity:27/131 - (20%)
Similarity:41/131 - (31%) Gaps:29/131 - (22%)


- Green bases have known domain annotations that are detailed below.


plant   471 PARCTMNNGGCWSDTRNGLTFSACSDSVSTGCKCPEG--FQGDGLT--CEDINECKERSVCQCS- 530
            |....:||..|          :.|.||:....|.|.|  |....|.  .|....|   ..|:.| 
Mouse   327 PEELAVNNDDC----------AICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSC---PTCRMSL 378

plant   531 ----GCRCKNSWGG-------YKCSCSGDRLYINDQDTCIERYGSKTAWWLTFLILAIVAVAGLA 584
                |.|.:....|       ...:.:..|..:|..:......||:.|.||....:.::....:.
Mouse   379 NIADGSRAREDHQGENLDENLVPVAAAEGRPRLNQHNHFFHFDGSRIASWLPSFSVEVMHTTNIL 443

plant   585 G 585
            |
Mouse   444 G 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040
VESA1_N <494..>564 CDD:289551 17/85 (20%)
EGF_CA 517..>545 CDD:238011 6/39 (15%)
AmfrNP_035917.2 HRD1 82..>378 CDD:227568 15/63 (24%)
zf-RING_2 335..375 CDD:290367 11/52 (21%)
CUE_AMFR 454..494 CDD:270604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 500..531
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..620
VCP/p97-interacting motif (VIM). /evidence=ECO:0000250|UniProtKB:Q9UKV5 618..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.