DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and H10E21.5

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:NP_497129.1 Gene:H10E21.5 / 175169 WormBaseID:WBGene00019185 Length:473 Species:Caenorhabditis elegans


Alignment Length:327 Identity:56/327 - (17%)
Similarity:97/327 - (29%) Gaps:138/327 - (42%)


- Green bases have known domain annotations that are detailed below.


plant   225 GGYTAFTPHYITWFCPFQFINSPHCKSQCINHGRYCAPDP--EDNFREGYEGKDVVLENLRQLCV 287
            ||.:.|.|.|..                      .||||.  :|:.|..:      .:|..|.|:
 Worm    55 GGGSTFLPAYTD----------------------LCAPDMKFDDSQRVFF------CKNCIQNCL 91

plant   288 HRVAN-----------ESSRPWVWWDYVTDFHSRCSMKEKKYSIDCAESYESLRLFSDLPIEKIK 341
            .||..           ::....|.|.:|....|......|:.:::.:.:.:|             
 Worm    92 SRVETAPKNILIVADVKAPNNRVSWFHVQTPVSNIRESGKQCNVENSNAMQS------------- 143

plant   342 KCIGDPEADTENQVLRTEQVSQIGRGNRGDVTILPTLVIN-------------NAQYRGRLER-- 391
                 || :|....||:...:.:   ....::.:..:||:             .|..:.||:|  
 Worm   144 -----PE-ETSTDALRSFSKTSV---LFVSISFIILMVISLAWLVFYYVQRFRYAHAKDRLQRRL 199

plant   392 -TAVLKAICAGFNETSEPAICLNTGLETNECLENNGGCWQDTKANITAC------QDTFRGRLCE 449
             .|..||:      |..|.:.:..|:.            |:.:::...|      ||..|...|:
 Worm   200 FNAARKAL------TRIPTMTITPGMT------------QELQSDCAVCLDPYQLQDVIRLLPCK 246

plant   450 -----------------CPVVKGVQYKGDGYTSCTPYGPARCTMNNGGCWSDTRNGLTFSACSDS 497
                             ||:.|....|..||                  |:|.||.:.....|..
 Worm   247 HIYHKSCIDPWLLEHRTCPMCKNDILKHFGY------------------WNDIRNDIQMPTNSRG 293

plant   498 VS 499
            ::
 Worm   294 IA 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040
VESA1_N <494..>564 CDD:289551 1/6 (17%)
EGF_CA 517..>545 CDD:238011
H10E21.5NP_497129.1 HRD1 <150..325 CDD:227568 31/185 (17%)
RING-H2_GRAIL 226..273 CDD:319582 8/46 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.