DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and rnf167

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:XP_005165694.2 Gene:rnf167 / 101055497 ZFINID:ZDB-GENE-110126-2 Length:401 Species:Danio rerio


Alignment Length:333 Identity:78/333 - (23%)
Similarity:117/333 - (35%) Gaps:93/333 - (27%)


- Green bases have known domain annotations that are detailed below.


plant    52 ANFG--LPDYGGFLIGSVVYPDSKTDGCSAFGKTFKPKFPRPT--------ILLLDRGGCYFALK 106
            |.||  ||..|  |:| |:......:.|:....  .|..|.|.        |:|:.|..|.|.:|
Zfish    46 ALFGSALPKDG--LMG-VLIEARPQNACTPIDP--PPASPTPADPNSTTKYIVLIRRYDCNFDVK 105

plant   107 AWHAQQAGAAAVLVADNVDEPLLTMDSPEESKDADGFIEKLTIPSVLIDKSFGDDLRQGF--QKG 169
            .:||||||.:|.:|.:.....||.|....|:     ..|:::|||| ....|...:....  :||
Zfish   106 VYHAQQAGYSAAIVHNMYSNSLLNMGYSNET-----IAEEISIPSV-FTSFFASQMLHKIIPEKG 164

plant   170 KNIVIKLDWRESVPHPDKRVEYELWTNSNDECG----------ARCDEQMDFVKNFKGHAQILEK 224
            ..:|:|.::  |.|     :.|.|...:...|.          .||.:....::..:...:.|:|
Zfish   165 AYVVLKPEF--SFP-----LSYYLIPFTGVVCMIIIVMVIIMIVRCVQHRKRLRKNRLSKEQLKK 222

plant   225 GGYTAFTPHYITWFCPFQFINSPHCKSQCINHGRYCAPDPEDNFREGYEGKDVVLENLRQL-CVH 288
                          .|....|.......|    ..|.    |.:.||        :.||.| |.|
Zfish   223 --------------IPIHKFNKGDSYDVC----AICL----DEYEEG--------DKLRVLPCSH 257

plant   289 RVANESSRPWVWWDYVTDFHSRCSMKEKKYSIDCAESYESLRLFSDLPIEKIKKCIGDPEA---D 350
            ...:....||     :|.....|.:.:::.:....|..||    ||          .|.||   |
Zfish   258 AYHSRCVDPW-----LTQTKKTCPVCKQRVTRPNPEYSES----SD----------SDEEAGPHD 303

plant   351 TENQVLRT 358
            .|.:..||
Zfish   304 AEEEDERT 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040 39/134 (29%)
VESA1_N <494..>564 CDD:289551
EGF_CA 517..>545 CDD:238011
rnf167XP_005165694.2 PA_C_RZF_like 14..177 CDD:239038 43/148 (29%)
RING-H2_RNF167 235..280 CDD:319711 14/65 (22%)
RING-H2 finger (C3H2C3-type) 237..278 CDD:319711 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.