DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment VSR7 and LOC100536511

DIOPT Version :9

Sequence 1:NP_001190777.1 Gene:VSR7 / 827757 AraportID:AT4G20110 Length:628 Species:Arabidopsis thaliana
Sequence 2:XP_021329973.1 Gene:LOC100536511 / 100536511 -ID:- Length:400 Species:Danio rerio


Alignment Length:399 Identity:82/399 - (20%)
Similarity:126/399 - (31%) Gaps:130/399 - (32%)


- Green bases have known domain annotations that are detailed below.


plant    65 GSVVYPDSKTDGCSAFGKTFKPKFPRPTILLLDRGGCYFALKAWHAQQAGAAAVLVADNVD---- 125
            |..|.|:|....||. ..||.... :|.|.|:..|.|.:..|...||:.||:||::. |.|    
Zfish    78 GLAVLPNSDPLACSK-NTTFTASH-QPWIALIKTGKCSYTKKINAAQREGASAVVIY-NEDGTGN 139

plant   126 EPLLTMDSPEESKDADGFIEKLTIPSVLIDKSFGDDLRQGFQKGKNIVIKLD-------WRESVP 183
            :.:|.|.|     .||..:      ::.|....|..:......|.::.:.::       |:.:  
Zfish   140 DVILMMYS-----GADDLV------AINIGNILGTQIAYLINNGLDVNMTINVATPTGVWKGT-- 191

plant   184 HPDKRVEYELWTNSNDECGARCDEQMDFVKNFKGHAQILEKGGYTAFTPHYITW-FCPFQFINSP 247
                      |.               :|.:|...       |.||.|..|..: |....:||..
Zfish   192 ----------WA---------------YVLSFTFI-------GITAVTMFYFAFLFMKRMYINRQ 224

plant   248 HCKSQC------------INHGRYCAPDPE------------DNFREGYEGKDVVLENLRQL-CV 287
            ..:.|.            :........|||            |:::.|        |.:..| |.
Zfish   225 LRRQQMEIKRETEKAIGKLEVRTLRTNDPEVDSDDTGCVVCTDSYQRG--------EQVTVLPCR 281

plant   288 HRVANESSRPWVWWDYVTDFHSRCSMKEKKYSIDCAESYESLRLFSDLPIEKIKKCIGDPEADTE 352
            |....:...||:.      .|..|.|  .||:|                   :|..|   |.|:.
Zfish   282 HLYHKKCIEPWLL------EHPTCPM--CKYNI-------------------LKSSI---EEDSY 316

plant   353 NQVLRTEQVSQIGRGNRGDVTILPTLVINNAQYRGRLERTAVLKAICAGFNETSEPAICLNTGLE 417
            :|...:...|.....|  |...|.|  |.:|..|..|:.....:....|  .||:...| |..:.
Zfish   317 DQPSPSSSSSSSSSSN--DTFCLAT--ITSADQRSTLQSNIQTEETAGG--HTSDTVNC-NLDIH 374

plant   418 TNECLENNG 426
            |....:|.|
Zfish   375 TQHIYDNPG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VSR7NP_001190777.1 PA_VSR 53..176 CDD:239040 30/114 (26%)
VESA1_N <494..>564 CDD:289551
EGF_CA 517..>545 CDD:238011
LOC100536511XP_021329973.1 PA_GRAIL_like 47..179 CDD:239037 30/114 (26%)
zf-rbx1 <188..303 CDD:331150 27/164 (16%)
RING_Ubox 262..308 CDD:327409 14/80 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.