DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ChiC and Cht10

DIOPT Version :9

Sequence 1:NP_001319999.1 Gene:ChiC / 827725 AraportID:AT4G19810 Length:379 Species:Arabidopsis thaliana
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:367 Identity:112/367 - (30%)
Similarity:170/367 - (46%) Gaps:46/367 - (12%)


- Green bases have known domain annotations that are detailed below.


plant    27 VVKASY----------WFPASE--FPVTDIDSSLFTHLFCAFADLNSQTNQV-TVSSANQPKFST 78
            ::..||          |:.:|:  |...|||::|.|||...||.|:|::..: |..|........
  Fly  1903 IINNSYKVVCYFTSWAWYRSSQGKFVPEDIDANLCTHLIYGFAVLDSKSLTIKTHDSWTDIDNRF 1967

plant    79 FTQTVQRRNPSVKTLLSIGG---GIADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWE 140
            :.:.|:.:...::.:|:|||   .:..|  ||.:..|..||:.|:.|.|.....:||.||||.||
  Fly  1968 YERVVEYKQRGLRVMLAIGGWNDSLGSK--YARLVLNSQSRRRFVASVISFLEQHGFEGLDLAWE 2030

plant   141 YP---------SSATEMTNFGTLLREWRSAVVAEA-SSSGKPRLLLAAAVFYSNNYYSVLYPVSA 195
            :|         .:.||...|..|::|     ::|| ..:|   |:|:|||..|.......|.|..
  Fly  2031 FPVCWQVNCNRGNPTEKDGFVALVKE-----LSEAFKENG---LILSAAVSPSKMVIDAGYNVFE 2087

plant   196 VASSLDWVNLMAYDFYGPGWSRVTGPPAALF---DPSNAGPSGDAGTRSWIQAGLPAKKAVLGFP 257
            ::...|||.:|.|||:| .|...||..|.||   ...|...:|:.....|::.|:|..|.|:|.|
  Fly  2088 LSPYFDWVAVMTYDFHG-HWDMRTGQIAPLFHRGGDENLYLNGNFSIHYWLERGIPNDKLVMGMP 2151

plant   258 YYGYAWRLTNANSHSYYAPTTGAA-----ISPDGSIGYGQIRKFIVDNGATTVYNST-VVGDYCY 316
            .||..:.|.:.|..|....|.|..     ...||.:.|.:|.:.:|::....|.:.. :.|.|.|
  Fly  2152 MYGQTFTLADQNRRSLNDKTVGPGKAGTFTRADGFLAYYEICEKVVNDDWKVVRDEEGIFGSYAY 2216

plant   317 AGTNWIGYDDNQSIVTKVRYAKQRGLLGYFSWHVGADDNSGL 358
            :|..||.|||..:|..|.::.|...|.|...|.:..||..||
  Fly  2217 SGNQWISYDDVTTIRRKSQFIKSLQLGGGMIWALDLDDFRGL 2258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ChiCNP_001319999.1 GH18_plant_chitinase_class_V 25..359 CDD:119358 112/367 (31%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 106/354 (30%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 110/360 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.