DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G19740 and Cht10

DIOPT Version :9

Sequence 1:NP_193709.3 Gene:AT4G19740 / 827718 AraportID:AT4G19740 Length:211 Species:Arabidopsis thaliana
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:233 Identity:69/233 - (29%)
Similarity:101/233 - (43%) Gaps:43/233 - (18%)


- Green bases have known domain annotations that are detailed below.


plant     4 NRTSRESFISSSISIARSLGFYGLDLAWEYP---------NNDVEMNNFGKLLQEWRSAVEVESQ 59
            |..||..|::|.||.....||.|||||||:|         .|..|.:.|..|::|...|.:... 
  Fly  2002 NSQSRRRFVASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKELSEAFKENG- 2065

plant    60 RTGIRPLLLTAAVYYTSDYNSVSYPVQAINRSLDWVNLIAYEFYG----LTTEIGP------PAG 114
                  |:|:|||..:.......|.|..::...|||.::.|:|:|    .|.:|.|      ...
  Fly  2066 ------LILSAAVSPSKMVIDAGYNVFELSPYFDWVAVMTYDFHGHWDMRTGQIAPLFHRGGDEN 2124

plant   115 LYDPSIKGPCGDTGLKHWLKAGLPEKKAVFGFPYVGWSWTLDD-------DKDHGDDVAVTHRVA 172
            ||      ..|:..:.:||:.|:|..|.|.|.|..|.::||.|       ||..|...|.|.   
  Fly  2125 LY------LNGNFSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVGPGKAGTF--- 2180

plant   173 VTANGSINYDQIVKFITEYKARTVYDSE-VVGFYCIAG 209
            ..|:|.:.|.:|.:.:.....:.|.|.| :.|.|..:|
  Fly  2181 TRADGFLAYYEICEKVVNDDWKVVRDEEGIFGSYAYSG 2218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G19740NP_193709.3 GH18_chitinase-like <23..211 CDD:415847 62/214 (29%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 69/233 (30%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 69/233 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D826687at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.