DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G19730 and Cht10

DIOPT Version :9

Sequence 1:NP_193708.1 Gene:AT4G19730 / 827717 AraportID:AT4G19730 Length:332 Species:Arabidopsis thaliana
Sequence 2:NP_001036422.1 Gene:Cht10 / 3355116 FlyBaseID:FBgn0250907 Length:2286 Species:Drosophila melanogaster


Alignment Length:318 Identity:91/318 - (28%)
Similarity:138/318 - (43%) Gaps:33/318 - (10%)


- Green bases have known domain annotations that are detailed below.


plant    33 ETIPSALFTHLFCAFADLDANSHKVFVSQAHEFIFSTFTE-TVKIRNPQVKTLLSIGGKNAN-NS 95
            |.|.:.|.|||...||.||:.|..:....:...|.:.|.| .|:.:...::.:|:|||.|.: .|
  Fly  1930 EDIDANLCTHLIYGFAVLDSKSLTIKTHDSWTDIDNRFYERVVEYKQRGLRVMLAIGGWNDSLGS 1994

plant    96 AFASMASNHQSRKTFIDSWIFIARSNGFHGLDLAWEYPY---------SDHEMTDFGNLVGELRA 151
            .:|.:..|.|||:.|:.|.|.....:||.|||||||:|.         :..|...|..||.||..
  Fly  1995 KYARLVLNSQSRRRFVASVISFLEQHGFEGLDLAWEFPVCWQVNCNRGNPTEKDGFVALVKELSE 2059

plant   152 AVEAESRRSSKPTLLLTAAVYYSSVYKTFTYPVQVMRESLDWVNIIAYDFYGPVSSSKFTVPTAG 216
            |.:...       |:|:|||..|.:.....|.|..:....|||.::.|||:|........:....
  Fly  2060 AFKENG-------LILSAAVSPSKMVIDAGYNVFELSPYFDWVAVMTYDFHGHWDMRTGQIAPLF 2117

plant   217 LHVSSNNEGPSGDSGLKQWIKDGLPEKKAVLGFSYVGWAWTLQNDKDTGYNAAAAGVAKSEDDVS 281
            ......|...:|:..:..|::.|:|..|.|:|....|..:||.:......|....|..|:.....
  Fly  2118 HRGGDENLYLNGNFSIHYWLERGIPNDKLVMGMPMYGQTFTLADQNRRSLNDKTVGPGKAGTFTR 2182

plant   282 EDGSINYAQIN--------KFIRDEEAAKVYDPKVVGHYCFAKKIWIGYEDTQSVEAK 331
            .||.:.|.:|.        |.:||||.       :.|.|.::...||.|:|..::..|
  Fly  2183 ADGFLAYYEICEKVVNDDWKVVRDEEG-------IFGSYAYSGNQWISYDDVTTIRRK 2233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G19730NP_193708.1 GH18_chitinase-like 11..332 CDD:415847 91/318 (29%)
Cht10NP_001036422.1 Glyco_18 220..565 CDD:214753
GH18_chitolectin_chitotriosidase 221..586 CDD:119351
ChtBD2 697..737 CDD:214696
CBM_14 801..848 CDD:279884
CBM_14 875..918 CDD:279884
Glyco_18 966..1310 CDD:214753
GH18_chitolectin_chitotriosidase 967..1331 CDD:119351
Glyco_18 1410..1753 CDD:214753
GH18_chitolectin_chitotriosidase 1411..1774 CDD:119351
ChtBD2 1834..1871 CDD:214696
Glyco_18 1909..2253 CDD:214753 91/318 (29%)
GH18_chitolectin_chitotriosidase 1910..2274 CDD:119351 91/318 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 188 1.000 Domainoid score I962
eggNOG 1 0.900 - - E1_COG3325
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1002
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11177
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.