DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G10160 and Rnf148

DIOPT Version :9

Sequence 1:NP_192754.1 Gene:AT4G10160 / 826607 AraportID:AT4G10160 Length:225 Species:Arabidopsis thaliana
Sequence 2:NP_001178011.1 Gene:Rnf148 / 681407 RGDID:1595417 Length:316 Species:Rattus norvegicus


Alignment Length:129 Identity:35/129 - (27%)
Similarity:57/129 - (44%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


plant    22 FTFIVCVPICVILIVLLVLYIMRRNSNTNVDWSSLGGFVPTNNNLST-AELGLSKDIRE---MLP 82
            |||:...      :..|.||...|               |...|.|| .:..:..|:::   .|.
  Rat   208 FTFLAAT------VAYLFLYCAWR---------------PRAPNSSTRRQRQIKSDVKKAIGQLQ 251

plant    83 IVIYKE---SFTVNDTQCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTCPLCRLSLI 143
            :.:.||   ....|:..|.||...|:|::.::.: :|.|.||..|||.||.:|.|||:|:..::
  Rat   252 LRVLKEGDKELDPNEDSCVVCFDIYKAQDVIRIL-TCKHFFHKTCIDPWLLAHRTCPMCKCDIL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G10160NP_192754.1 HRD1 <73..>173 CDD:227568 24/77 (31%)
RING-H2_EL5_like 96..139 CDD:319375 18/42 (43%)
Rnf148NP_001178011.1 PA_GRAIL_like 56..190 CDD:239037
zf-RING_2 267..310 CDD:290367 18/43 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I4247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.