DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G10160 and Rnf128

DIOPT Version :9

Sequence 1:NP_192754.1 Gene:AT4G10160 / 826607 AraportID:AT4G10160 Length:225 Species:Arabidopsis thaliana
Sequence 2:NP_075759.3 Gene:Rnf128 / 66889 MGIID:1914139 Length:428 Species:Mus musculus


Alignment Length:148 Identity:37/148 - (25%)
Similarity:67/148 - (45%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


plant    97 CSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTCPLCRLSLIPKPSVDLSHQ----SIEI 157
            |:||:..|:..: |.::.:|.|.||..|:|.||..|.|||:|:..::....:::..:    |:::
Mouse   277 CAVCIELYKPND-LVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQV 340

plant   158 VSSIENTN---------------GGEASTQ--------PDSQSATEAIIHIDDVEEGNRDSIEVV 199
            ..|.|.:|               .|.||.|        ..:|||.|.:..::  .|.|..:::||
Mouse   341 PVSNEASNTASPHEEDSRSETASSGYASVQGADEPPLEEHAQSANENLQLVN--HEANSVAVDVV 403

plant   200 --------KESEENDRNS 209
                    :|.|..|:.:
Mouse   404 PHVDNPTFEEDETPDQEA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G10160NP_192754.1 HRD1 <73..>173 CDD:227568 26/102 (25%)
RING-H2_EL5_like 96..139 CDD:319375 17/41 (41%)
Rnf128NP_075759.3 PA_GRAIL_like 48..193 CDD:239037
zf-RING_2 275..318 CDD:290367 17/41 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..428 18/82 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I4518
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.