DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G10160 and Rnf130

DIOPT Version :9

Sequence 1:NP_192754.1 Gene:AT4G10160 / 826607 AraportID:AT4G10160 Length:225 Species:Arabidopsis thaliana
Sequence 2:XP_038942740.1 Gene:Rnf130 / 652955 RGDID:1562041 Length:439 Species:Rattus norvegicus


Alignment Length:227 Identity:51/227 - (22%)
Similarity:98/227 - (43%) Gaps:43/227 - (18%)


- Green bases have known domain annotations that are detailed below.


plant     8 TYIPSNSTESQILKFTFIVCVPICVILIVLLVLYIMRRNSNTNVDWSSLGGFVPTNNNLSTAELG 72
            |.:|..:.....|.|..|..:.:.:|....|:.|.:::...||.            .:.:...||
  Rat   183 TRMPPKNFSRGSLVFVSISFIVLMIISSAWLIFYFIQKIRYTNA------------RDRNQRRLG 235

plant    73 --LSKDIREMLPIVIYK-ESFTVND-TQCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHT 133
              ..|.|.::....:.| :..|..| ..|:||:..|:..:.::.:| |.|.||..|:|.||:.|.
  Rat   236 DAAKKAISKLTTRTVKKGDKETDPDFDHCAVCIESYKQNDVVRVLP-CKHVFHKSCVDPWLSEHC 299

plant   134 TCPLCRLSLIPKPSVDLSHQSIEIVSSIENTNGGEASTQPDSQSATEAIIH---IDDVEEGNRDS 195
            |||:|:|:::         :::.||.::..|:  ..:...:..:.|:|:..   :.|:...:...
  Rat   300 TCPMCKLNIL---------KALGIVPNLPCTD--NVAFDMERLTRTQAVNRRSALGDLANDSSLG 353

plant   196 IEVVKESEENDRNSVGTS----DGCCSCRLGE 223
            :|.::.|        |.|    ||..:.|.||
  Rat   354 LEPLRTS--------GISPLPQDGELTPRTGE 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G10160NP_192754.1 HRD1 <73..>173 CDD:227568 27/101 (27%)
RING-H2_EL5_like 96..139 CDD:319375 17/42 (40%)
Rnf130XP_038942740.1 PA_GRAIL_like 40..179 CDD:239037
HRD1 <197..366 CDD:227568 43/200 (22%)
RING-H2_RNF130 262..310 CDD:319717 19/57 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 66 1.000 Domainoid score I4247
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.