powered by:
Protein Alignment AT4G10160 and rnf11.2
DIOPT Version :9
Sequence 1: | NP_192754.1 |
Gene: | AT4G10160 / 826607 |
AraportID: | AT4G10160 |
Length: | 225 |
Species: | Arabidopsis thaliana |
Sequence 2: | NP_001006833.1 |
Gene: | rnf11.2 / 448572 |
XenbaseID: | XB-GENE-5888819 |
Length: | 146 |
Species: | Xenopus tropicalis |
Alignment Length: | 43 |
Identity: | 17/43 - (39%) |
Similarity: | 27/43 - (62%) |
Gaps: | 1/43 - (2%) |
- Green bases have known domain annotations that are detailed below.
plant 96 QCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTCPLC 138
:|.:|:.|:...:.::.:| |.|.:|:||||.||....|||.|
Frog 90 ECVICMLDFVGGDPVRFLP-CMHIYHVECIDDWLMRSFTCPSC 131
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
65 |
1.000 |
Domainoid score |
I4324 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
61 |
1.000 |
Inparanoid score |
I2981 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X150 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.050 |
|
Return to query results.
Submit another query.