DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G10160 and rnf44

DIOPT Version :10

Sequence 1:NP_192754.1 Gene:AT4G10160 / 826607 AraportID:AT4G10160 Length:225 Species:Arabidopsis thaliana
Sequence 2:XP_004912927.2 Gene:rnf44 / 100493970 XenbaseID:XB-GENE-1017306 Length:505 Species:Xenopus tropicalis


Alignment Length:69 Identity:29/69 - (42%)
Similarity:41/69 - (59%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


plant    72 GLSKDIREMLPIVIYK-ESFTVNDTQCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTC 135
            ||:|...|.||...:. ||.....|.|.||..|:::.:.|:.:| |.|.||.:|:|.||.|:.||
 Frog   427 GLTKANIEQLPSYRFNAESHQSEQTLCVVCFSDFESRQLLRVLP-CNHEFHAKCVDKWLKSNRTC 490

plant   136 PLCR 139
            |:||
 Frog   491 PICR 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G10160NP_192754.1 HRD1 <73..>173 CDD:227568 28/68 (41%)
RING-H2_EL5-like 96..139 CDD:438124 18/42 (43%)
rnf44XP_004912927.2 RING_Ubox 444..505 CDD:473075 23/52 (44%)

Return to query results.
Submit another query.