powered by:
Protein Alignment AT4G10160 and rnf44
DIOPT Version :9
Sequence 1: | NP_192754.1 |
Gene: | AT4G10160 / 826607 |
AraportID: | AT4G10160 |
Length: | 225 |
Species: | Arabidopsis thaliana |
Sequence 2: | XP_004912927.2 |
Gene: | rnf44 / 100493970 |
XenbaseID: | XB-GENE-1017306 |
Length: | 505 |
Species: | Xenopus tropicalis |
Alignment Length: | 69 |
Identity: | 29/69 - (42%) |
Similarity: | 41/69 - (59%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
plant 72 GLSKDIREMLPIVIYK-ESFTVNDTQCSVCLGDYQAEEKLQQMPSCGHTFHMECIDLWLTSHTTC 135
||:|...|.||...:. ||.....|.|.||..|:::.:.|:.:| |.|.||.:|:|.||.|:.||
Frog 427 GLTKANIEQLPSYRFNAESHQSEQTLCVVCFSDFESRQLLRVLP-CNHEFHAKCVDKWLKSNRTC 490
plant 136 PLCR 139
|:||
Frog 491 PICR 494
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
65 |
1.000 |
Domainoid score |
I4324 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.