DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G10150 and rnf11a

DIOPT Version :9

Sequence 1:NP_192753.1 Gene:AT4G10150 / 826606 AraportID:AT4G10150 Length:236 Species:Arabidopsis thaliana
Sequence 2:NP_957315.1 Gene:rnf11a / 393996 ZFINID:ZDB-GENE-040426-1277 Length:146 Species:Danio rerio


Alignment Length:89 Identity:26/89 - (29%)
Similarity:45/89 - (50%) Gaps:13/89 - (14%)


- Green bases have known domain annotations that are detailed below.


plant    75 PTNNNLSTAELGLSKDIR--------EMLPVVIY---KESFIVKDSQCSVCLGDYQAEEKLQQMP 128
            |:...|:| :|...:.:|        :.||..|:   .|....|..:|.:|:.|::..:.::.:|
Zfish    45 PSQTRLAT-QLTEEEQVRIAQRIGLIQHLPRGIFDPGSEPSDKKIKECVICMMDFEYGDPIRFLP 108

plant   129 SCGHTFHMECIDLWLTSHTTCPLC 152
             |.|.:|::|||.||....|||.|
Zfish   109 -CMHIYHVDCIDAWLMRSFTCPSC 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G10150NP_192753.1 COG5540 <16..158 CDD:227827 26/89 (29%)
RING-H2_EL5_like 110..153 CDD:319375 16/43 (37%)
rnf11aNP_957315.1 Vinculin <10..>70 CDD:279395 5/25 (20%)
zf-RING_2 90..131 CDD:290367 15/41 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I4583
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X150
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.