DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G09560 and DMA1

DIOPT Version :9

Sequence 1:NP_192694.2 Gene:AT4G09560 / 826540 AraportID:AT4G09560 Length:448 Species:Arabidopsis thaliana
Sequence 2:NP_011983.1 Gene:DMA1 / 856515 SGDID:S000001157 Length:416 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:48/222 - (21%)
Similarity:84/222 - (37%) Gaps:57/222 - (25%)


- Green bases have known domain annotations that are detailed below.


plant   114 FGFLVSMAGNPSGVLI--YGTFVSKATGEVLKEY---------AGRTD--FEV-----WLMPSFE 160
            |..::..||..|.::|  |...|.:|..::..:|         ..||.  |:|     |.:...:
Yeast   176 FDPIIRTAGAGSQIIIGRYTERVREAISKIPDQYHPVVFKSKVISRTHGCFKVDDQGNWFLKDVK 240

plant   161 TSAWSIMAISFISLLAMSAVLATCFFVRRHRVRRRRILALNGNDF-------HRMPKSMI----- 213
            :|:.     :|::...:|:...|.   :.:.:....|:.| |.||       :|..|..|     
Yeast   241 SSSG-----TFLNHQRLSSASTTS---KDYLLHDGDIIQL-GMDFRGGTEEIYRCVKMKIELNKS 296

plant   214 IRMPTTIFNGICDEATTSIL-------------CCICLENYEKGDKLRILPCHHKFHVACVD--L 263
            .::....||   .||.:.|.             |.|||...:....:.|.||.|.:|..||.  :
Yeast   297 WKLKANAFN---KEALSRIKNLQKLTTGLEQEDCSICLNKIKPCQAIFISPCAHSWHFHCVRRLV 358

plant   264 WLGQRKSFCPVCKRDARSISTDKPPSE 290
            .:...:..||.|:.:....:|.:..||
Yeast   359 IMNYPQFMCPNCRTNCDLETTLESESE 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G09560NP_192694.2 PA_C_RZF_like 19..163 CDD:239038 14/66 (21%)
zf-RING_2 234..276 CDD:290367 13/43 (30%)
DMA1NP_011983.1 FHA 121..308 CDD:224630 28/143 (20%)
RING-H2_Dmap_like 325..371 CDD:319372 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.