DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT4G09560 and SPAC57A7.09

DIOPT Version :9

Sequence 1:NP_192694.2 Gene:AT4G09560 / 826540 AraportID:AT4G09560 Length:448 Species:Arabidopsis thaliana
Sequence 2:NP_593372.1 Gene:SPAC57A7.09 / 2542187 PomBaseID:SPAC57A7.09 Length:372 Species:Schizosaccharomyces pombe


Alignment Length:248 Identity:70/248 - (28%)
Similarity:111/248 - (44%) Gaps:53/248 - (21%)


- Green bases have known domain annotations that are detailed below.


plant    81 YVLIIRGGCSFEDKIRNAQKAGYKAAIVYDYED-----FGFLVSM-AGNPSGVLIYGTFVSKAT- 138
            ::|:.||.|::.||...||:.|:|..||.|...     ..::|:. ..:.|.|.|...|||.:: 
pombe   144 FLLVQRGKCTYFDKALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSY 208

plant   139 ----GEVLKEYAGRTDFEVWLMP-SFETSAWSIM---AISFISLLAMSAVLATCFFVRRHRV--R 193
                .::|..|  |...:::..| ......|..:   :.|.|.|:.:.| ||...|:|.:|.  :
pombe   209 NLLWSDLLHSY--RQPLKLYAKPEELGDMFWPFLLCFSPSIIMLITVQA-LAIRKFIRTYRTKSK 270

plant   194 RRRILALNGNDFHRMPKSMIIR---------MPTTIFNG----ICDE----ATTSILCCICLENY 241
            .||.:       ..:|...|.|         :..:..||    :.||    ||..:.|.||||::
pombe   271 TRRFI-------EDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLESF 328

plant   242 EKGDKLRILPCHHKFHVACVDLWLGQRKSFCPVCKRDARSISTDKPPSEHTPF 294
            .||||:..|||.|:||..|:..|:...:..||.|       :|:.||.:  ||
pombe   329 TKGDKVVALPCKHEFHRPCIAKWIVDYRHACPTC-------NTEVPPPK--PF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT4G09560NP_192694.2 PA_C_RZF_like 19..163 CDD:239038 24/93 (26%)
zf-RING_2 234..276 CDD:290367 19/41 (46%)
SPAC57A7.09NP_593372.1 COG5540 1..369 CDD:227827 67/241 (28%)
Peptidases_S8_S53 <144..211 CDD:299169 20/66 (30%)
zf-RING_2 320..362 CDD:290367 19/41 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 59 1.000 Domainoid score I3131
eggNOG 1 0.900 - - E1_KOG4628
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I2016
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm8357
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X670
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.