Sequence 1: | XP_005259352.1 | Gene: | CAPNS1 / 826 | HGNCID: | 1481 | Length: | 322 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001286613.1 | Gene: | CalpA / 37232 | FlyBaseID: | FBgn0012051 | Length: | 843 | Species: | Drosophila melanogaster |
Alignment Length: | 284 | Identity: | 77/284 - (27%) |
---|---|---|---|
Similarity: | 108/284 - (38%) | Gaps: | 99/284 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 53 GGGGTAMRILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSA 117
Human 118 TELMNILNK----------VVTRH-----------------------------PDLK-------- 135
Human 136 -----------------------------TDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNI 171
Human 172 KRWQAIYKQFDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRL 236
Human 237 DAMFRAFKSLDKDGTGQIQVNIQE 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CAPNS1 | XP_005259352.1 | EFh_PEF_CPNS1_2 | 100..260 | CDD:320063 | 67/235 (29%) |
EF-hand motif | 100..128 | CDD:320063 | 14/37 (38%) | ||
EF-hand motif | 142..172 | CDD:320063 | 18/29 (62%) | ||
EF-hand motif | 173..203 | CDD:320063 | 9/29 (31%) | ||
EF-hand motif | 209..237 | CDD:320063 | 10/27 (37%) | ||
CalpA | NP_001286613.1 | Peptidase_C2 | 104..400 | CDD:279042 | |
Calpain_III | 418..565 | CDD:279416 | |||
EFh | 719..765 | CDD:238008 | 24/45 (53%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |