Sequence 1: | XP_005259352.1 | Gene: | CAPNS1 / 826 | HGNCID: | 1481 | Length: | 322 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573118.2 | Gene: | CalpC / 32597 | FlyBaseID: | FBgn0260450 | Length: | 681 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 56/207 - (27%) |
---|---|---|---|
Similarity: | 98/207 - (47%) | Gaps: | 11/207 - (5%) |
- Green bases have known domain annotations that are detailed below.
Human 59 MRILGGVISAISEAAAQ----YNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATE 119
Human 120 LMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTD 184
Human 185 RSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKD 249
Human 250 GTGQIQVNIQEV 261 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CAPNS1 | XP_005259352.1 | EFh_PEF_CPNS1_2 | 100..260 | CDD:320063 | 44/159 (28%) |
EF-hand motif | 100..128 | CDD:320063 | 7/27 (26%) | ||
EF-hand motif | 142..172 | CDD:320063 | 10/29 (34%) | ||
EF-hand motif | 173..203 | CDD:320063 | 6/29 (21%) | ||
EF-hand motif | 209..237 | CDD:320063 | 7/27 (26%) | ||
CalpC | NP_573118.2 | CysPc | 7..329 | CDD:238004 | |
Calpain_III | 346..483 | CDD:238132 | 5/12 (42%) | ||
FRQ1 | <567..648 | CDD:227455 | 22/80 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |