DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAPNS1 and CalpC

DIOPT Version :9

Sequence 1:XP_005259352.1 Gene:CAPNS1 / 826 HGNCID:1481 Length:322 Species:Homo sapiens
Sequence 2:NP_573118.2 Gene:CalpC / 32597 FlyBaseID:FBgn0260450 Length:681 Species:Drosophila melanogaster


Alignment Length:207 Identity:56/207 - (27%)
Similarity:98/207 - (47%) Gaps:11/207 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    59 MRILGGVISAISEAAAQ----YNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATE 119
            :||||.....:|....|    .:|.|....|........:.:.|.|:..::.|||.::..::..|
  Fly   470 VRILGTGSFRLSCLETQTMILLDPFPALKSTDAERCGGPKVKSVCQYEPVYMQLADENKTINCFE 534

Human   120 LMNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTD 184
            |..:|...:..  |.......||.||.::|:.|...:|::.|::||....|:|.||.::|.:..:
  Fly   535 LHELLEACLPN--DYIKGCANIDICRQVIALQDRSGSGRITFQQFKTFMVNLKSWQGVFKMYTKE 597

Human   185 RSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKD 249
            ::|.:.:..|..|....||.|:..:.|.:|:||..:.|.:...:|:|.::.|...|..| .|...
  Fly   598 KAGILRAERLRDALCDIGFQLSTDIMNCLIQRYIRKDGTLRLSDFVSAVIHLTTAFNQF-HLKNY 661

Human   250 GTGQIQVNIQEV 261
            |    |||:.||
  Fly   662 G----QVNVIEV 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNS1XP_005259352.1 EFh_PEF_CPNS1_2 100..260 CDD:320063 44/159 (28%)
EF-hand motif 100..128 CDD:320063 7/27 (26%)
EF-hand motif 142..172 CDD:320063 10/29 (34%)
EF-hand motif 173..203 CDD:320063 6/29 (21%)
EF-hand motif 209..237 CDD:320063 7/27 (26%)
CalpCNP_573118.2 CysPc 7..329 CDD:238004
Calpain_III 346..483 CDD:238132 5/12 (42%)
FRQ1 <567..648 CDD:227455 22/80 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.