DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAPNS1 and Capns1

DIOPT Version :9

Sequence 1:XP_005259352.1 Gene:CAPNS1 / 826 HGNCID:1481 Length:322 Species:Homo sapiens
Sequence 2:NP_033925.2 Gene:Capns1 / 12336 MGIID:88266 Length:268 Species:Mus musculus


Alignment Length:261 Identity:247/261 - (94%)
Similarity:254/261 - (97%) Gaps:2/261 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGG-GGGGGGGGTAMRILGG 64
            ||||||||| ||||||||||||||||||||||||||.|||||||||.| ||||||||||||||||
Mouse     1 MFLVNSFLK-GGGGGGGGGGLGGGLGNVLGGLISGAAGGGGGGGGGMGLGGGGGGGGTAMRILGG 64

Human    65 VISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATELMNILNKVVT 129
            ||||||||||||||||||||:|||||||||||||||||:||.|||||||||||||||||||||||
Mouse    65 VISAISEAAAQYNPEPPPPRSHYSNIEANESEEVRQFRKLFVQLAGDDMEVSATELMNILNKVVT 129

Human   130 RHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQFDTDRSGTICSSEL 194
            |||||||||||||||||||||||||||||||||||||||||||:||||||:|||||||||.|.||
Mouse   130 RHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKKWQAIYKRFDTDRSGTIGSHEL 194

Human   195 PGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQ 259
            ||||||||||||||||:||||||:||||||||||||||||||||||||||||||:||||||||||
Mouse   195 PGAFEAAGFHLNEHLYSMIIRRYADESGNMDFDNFISCLVRLDAMFRAFKSLDKNGTGQIQVNIQ 259

Human   260 E 260
            |
Mouse   260 E 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAPNS1XP_005259352.1 EFh_PEF_CPNS1_2 100..260 CDD:320063 150/159 (94%)
EF-hand motif 100..128 CDD:320063 25/27 (93%)
EF-hand motif 142..172 CDD:320063 29/29 (100%)
EF-hand motif 173..203 CDD:320063 25/29 (86%)
EF-hand motif 209..237 CDD:320063 25/27 (93%)
Capns1NP_033925.2 EFh_PEF_CPNS1_2 100..268 CDD:320063 152/161 (94%)
EF-hand motif 100..128 CDD:320063 25/27 (93%)
EF-hand motif 142..172 CDD:320063 29/29 (100%)
EF-hand motif 173..203 CDD:320063 25/29 (86%)
EF-hand motif 209..237 CDD:320063 25/27 (93%)
EF-hand motif 238..268 CDD:320063 22/23 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83969826
Domainoid 1 1.000 210 1.000 Domainoid score I24127
eggNOG 1 0.900 - - E1_KOG0037
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1327
Inparanoid 1 1.050 516 1.000 Inparanoid score I11936
Isobase 1 0.950 - 0 Normalized mean entropy S3436
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG46114
OrthoDB 1 1.010 - - D1330600at2759
OrthoFinder 1 1.000 - - FOG0004825
OrthoInspector 1 1.000 - - oto116515
orthoMCL 1 0.900 - - OOG6_114949
Panther 1 1.100 - - LDO PTHR46735
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R12004
SonicParanoid 1 1.000 - - X4500
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1919.250

Return to query results.
Submit another query.