DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment EPC1 and sotv

DIOPT Version :9

Sequence 1:NP_191142.1 Gene:EPC1 / 824749 AraportID:AT3G55830 Length:334 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:293 Identity:95/293 - (32%)
Similarity:150/293 - (51%) Gaps:39/293 - (13%)


- Green bases have known domain annotations that are detailed below.


plant    51 RSSRPWVNSSIAVADR----------ISGSRKGYTLLMNTWKRYDLLKKSVSHYASCSRLDSIHI 105
            ||||.|  ::|....|          ::...:|:|.::.|:.|.:.|...:...|....|.||.:
  Fly   424 RSSRQW--NTIDTNARSTFNPLFLPSLAPKSQGFTAVILTYDRVESLFLLIQKLAVVPSLQSILV 486

plant   106 VWS--EPNPPSESLKEYLHNVLKKKTRDGHEVELRFDINKEDSLNNRFKEIKDLKTDAVFSIDDD 168
            :|:  :.:||..|....:...||.:.            .||:.|:|||....:::|:|:.:||||
  Fly   487 IWNNQKKSPPHLSTFPSISKPLKIRQ------------TKENKLSNRFYPYPEIETEAILTIDDD 539

plant   169 II-FPCHTVDFAFNVWESAPDTMVGFVPRVHWPEKSNDKANYYTYSGWWSVWWSGTYSMVLSKAA 232
            || .....:||.:.||...||.:|||..|:|..|....:.:|.:.       |:...||||:.||
  Fly   540 IIMLTTDELDFGYEVWREFPDHIVGFPSRIHVWENVTMRWHYESE-------WTNQISMVLTGAA 597

plant   233 FFHKKYLSLYTNSMPASIREFTTKNRNCEDIAMSFLIANATNAPAIWV----KGKIYEIGSTGIS 293
            |.||.:..:||::||..|:::..::.|||||||:||:||.||.|.|.|    |.|..|..:|.:.
  Fly   598 FHHKYWSHMYTHAMPGDIKDWVDEHMNCEDIAMNFLVANITNNPPIKVTPRKKFKCPECTNTEML 662

plant   294 SIG-GHTEKRTHCVNRFVAEFGKMPLVYTSMKA 325
            |.. .|..:|:.|::||...:|:|||.....:|
  Fly   663 SADLNHMRERSACIDRFSKIYGRMPLRTVEFRA 695

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
EPC1NP_191142.1 Glyco_transf_64 74..322 CDD:286358 86/255 (34%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069
Glyco_transf_64 455..689 CDD:286358 85/252 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 135 1.000 Domainoid score I1610
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3064
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.