DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PHIP1 and eIF4B

DIOPT Version :9

Sequence 1:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana
Sequence 2:NP_001015319.1 Gene:eIF4B / 3355041 FlyBaseID:FBgn0020660 Length:459 Species:Drosophila melanogaster


Alignment Length:360 Identity:74/360 - (20%)
Similarity:124/360 - (34%) Gaps:106/360 - (29%)


- Green bases have known domain annotations that are detailed below.


plant   189 KVDCKMRPEDGAFSGIAFITFDTEDGAKRALAFDRAAMGDRYLTIQQYVKTTTP---------SI 244
            :|..|:|..||.         |::||:           |...|.   |...|.|         ||
  Fly    33 QVSKKIRNLDGD---------DSDDGS-----------GTLPLV---YQLPTAPRANRIFDDNSI 74

plant   245 PRRKTSSGFAPEMVDGYNRVYIGNLAWDTTERDIRKLFSDCVINSVRLGK-NKETGEFKGYAHVD 308
            |.:      ||.:      .||.||.:|..|.|:.:.|....:.|:||.: :.|.|..:|:.:|:
  Fly    75 PHK------APFI------AYINNLPFDANEDDLYEFFEGINLISLRLPREDGENGRSRGFGYVE 127

plant   309 FKDSVSVAIALKLDQQVICGRPVKICCA----LKDRPATDH------TPGETNNAGSYNMEDTYA 363
            .::...:...|.|....|.||.::|..:    .:.|..::.      ..|:..::|::.      
  Fly   128 LENREDLIHVLSLPDPSIKGRRIRIELSNENDQQSRQKSNRRFDGFGNNGDNRDSGNWR------ 186

plant   364 AADPVPALAGRSEVDDGNYFATTVSSSKVKRRVCYECGEKGHLSTACPIKLQKADDQANSKLGQE 428
                      |...::|:.|.   .||..:|....|       ..:.|.:     |..|:. |..
  Fly   187 ----------RDSQNNGSNFG---YSSNFERSFNRE-------RKSLPDR-----DDVNTP-GSW 225

plant   429 TVDGRPAMQSYGLPKNSGDSYYMNETYASTNETYNGGYSASAVGTGKVKRRNCYECGEKGHLSTA 493
            ....||  ||........:...::|.|..                |:||..:.|...|...:...
  Fly   226 RTSARP--QSIDTSPTRREVEQVSEKYRE----------------GRVKIADRYSREETSKVEEE 272

plant   494 CPIKLQNTSHTNSTLDHQTVEAGPTQVTSYSLQKK 528
            .| ||.....|....|.:|:|.....|..::|.|:
  Fly   273 RP-KLNLKPRTLPLPDVKTIEFEKCDVDEFNLDKQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PHIP1NP_191094.1 RRM <129..327 CDD:223796 35/147 (24%)
RRM1_PHIP1 163..234 CDD:240717 10/44 (23%)
RRM2_PHIP1 263..334 CDD:240718 20/71 (28%)
PTZ00368 393..592 CDD:173561 27/136 (20%)
eIF4BNP_001015319.1 RRM <72..268 CDD:223796 51/257 (20%)
RRM_eIF4B 79..155 CDD:240848 22/81 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.