DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AT3G42180 and sotv

DIOPT Version :9

Sequence 1:NP_189804.4 Gene:AT3G42180 / 823191 AraportID:AT3G42180 Length:470 Species:Arabidopsis thaliana
Sequence 2:NP_725536.1 Gene:sotv / 3772101 FlyBaseID:FBgn0029175 Length:717 Species:Drosophila melanogaster


Alignment Length:479 Identity:100/479 - (20%)
Similarity:169/479 - (35%) Gaps:159/479 - (33%)


- Green bases have known domain annotations that are detailed below.


plant    21 LLSFLLFSSFPNNESPPQQFFSSLTMSSLLVHTNALQSSSSSSSLYSPP----ITVKRRS----- 76
            ||||:..|...::.:|.:...:.||...|::  .||.:......|.|.|    ...||.|     
  Fly     7 LLSFVTQSRAISHTNPREHILNCLTYGLLVI--VALCAGFLLWDLSSSPRDGFFHGKRDSHTLIL 69

plant    77 NLEKREEELRKARAAIRRAVRFKNCTSNEEVITYIPTGQIYRNSFAFHQSHIEMMKTFKVWSYKE 141
            :|| ..:||.....|.:|| |..|||              :.:....::...:.:|.:       
  Fly    70 DLE-HIQELAVNPEAEQRA-RNVNCT--------------FWDCLNIYKCEHDRLKVY------- 111

plant   142 GEQPLVHDGPVNDIYGIEGQFIDE----------------LSYVMGGPSGRFRASRPEEAHAFFL 190
                         ||.:: :|:||                |..|:   ..|:..|.|.||..|..
  Fly   112 -------------IYPLQ-EFVDEQSDKTATTLSSEYFQILEAVL---KSRYYTSNPNEACLFLP 159

plant   191 PFSVANIVHYVYQPITSPADFNRARLHRIFNDYVDVVA-HKHPFWNQSNGADHFMVSCHDWAPDV 254
            ...:.|                    ..:|:.::...| ....||::  ||:|.:.:.      :
  Fly   160 SLDLLN--------------------QNVFDKHLAGAALASLDFWDR--GANHIIFNM------L 196

plant   255 PDSKPEFFKNFMRGLCNANT-----------SEGFRRNIDFSIPE-------------------I 289
            |...|.:     ..:.:.||           |..:|...|.:||.                   :
  Fly   197 PGGAPSY-----NTVLDVNTDNAIIFGGGFDSWSYRPGFDVAIPVWSPRLVRQHAHATAQRKFLL 256

plant   290 NIPKRKLKPPFMGQNPENRTILAFFAGRAHGYIREVLFSHWKG-------KDKDVQVYDHLT--- 344
            .:.:..:.|.|:      ||            :||:..:|.:.       ::.|:.:...|:   
  Fly   257 VVAQLNILPRFV------RT------------LRELSLAHSEQLLLLGACENLDLTMRCPLSQHH 303

plant   345 KGQNYHELIGHSKFCLCPSGYEVASPREVEAIYSGCVPVVISDNYSLPFNDVLDWSKFSVEIPVD 409
            |...|..|:...||||......:..|..||.:...|:||:..|||.|||.||:|||..||.|..:
  Fly   304 KSLEYPRLLSRGKFCLLGRSLRMGQPDLVEIMSQHCIPVIAVDNYVLPFEDVIDWSLASVRIREN 368

plant   410 KIPDIKKILQEIPHDKYLRMYRNV 433
            ::..:.:.|:.|...|.:.|.:.|
  Fly   369 ELHSVMQKLKAISSVKIVEMQKQV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AT3G42180NP_189804.4 Exostosin 130..421 CDD:281069 68/347 (20%)
sotvNP_725536.1 Exostosin 105..380 CDD:281069 68/349 (19%)
Glyco_transf_64 455..689 CDD:286358
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2684
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D789556at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X187
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.