DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CYP707A4 and Cyp12d1-d

DIOPT Version :9

Sequence 1:NP_566628.1 Gene:CYP707A4 / 821461 AraportID:AT3G19270 Length:468 Species:Arabidopsis thaliana
Sequence 2:NP_995812.1 Gene:Cyp12d1-d / 2768720 FlyBaseID:FBgn0053503 Length:521 Species:Drosophila melanogaster


Alignment Length:296 Identity:74/296 - (25%)
Similarity:117/296 - (39%) Gaps:80/296 - (27%)


- Green bases have known domain annotations that are detailed below.


plant   163 IVS--TYQEMKKFAFDVGILAIFGHLESSYKEILKHNYNIVDKGYNSFPMSLPGTSYHKALMARK 225
            |:|  ||::||:...|        .|..|.| :||.|.:.::|                    |:
  Fly   257 IISTPTYRKMKRTLND--------SLNVSQK-MLKENQDALEK--------------------RR 292

plant   226 QL-KTIVSEIICERREKRALQTDFLGHLLNFKNEKGRVLTQEQIADNIIGVLFAAQDTTASCLTW 289
            |. :.|.|..:.||             |:....:...:::        :.:|||..|.||:.|:.
  Fly   293 QAGEKINSNSMLER-------------LMEIDPKVAVIMS--------LDILFAGVDATATLLSA 336

plant   290 ILKYL--HDD------QKLLEAVKAEQKAIYEENSREKKPLTWRQTRNMPLTHKVIVESLRMASI 346
            :|..|  |.|      ::||..:..:...:.|||.::           ||....||.|:||....
  Fly   337 VLLCLSKHPDKQAKLREELLSIMPTKDSLLNEENMKD-----------MPYLRAVIKETLRYYPN 390

plant   347 ISFTFREAVVDVEYKGYLIPKGWKVMPLFRNIHHNPKYFSNPEVFDPSRFEVNPK--------PN 403
            ...|.|....||...||.:|||..|:.....:.....|:..|:.|.|.|:..:|:        |.
  Fly   391 GFGTMRTCQNDVILSGYRVPKGTTVLLGSNVLMKEATYYPRPDEFLPERWLRDPETGKKMQVSPF 455

plant   404 TFMPFGSGVHACPGNELAKLQILIFLHHLVSNFRWE 439
            ||:|||.|...|.|..:..|::...:..|:.||..|
  Fly   456 TFLPFGFGPRMCIGKRVVDLEMETTVAKLIRNFHVE 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CYP707A4NP_566628.1 p450 6..467 CDD:299894 74/296 (25%)
Cyp12d1-dNP_995812.1 p450 70..508 CDD:299894 74/296 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.