DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MPK9 and rl

DIOPT Version :9

Sequence 1:NP_001327296.1 Gene:MPK9 / 821329 AraportID:AT3G18040 Length:648 Species:Arabidopsis thaliana
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:362 Identity:163/362 - (45%)
Similarity:233/362 - (64%) Gaps:26/362 - (7%)


- Green bases have known domain annotations that are detailed below.


plant   120 TEFFTEYGEASRYQIQEV---------IGKGSYGVVASAIDTHSGEKVAIKKINDVFEHVSDATR 175
            ||......|..|.||.||         ||:|:||:|.||.||.:.::||||||:. |||.:...|
  Fly    17 TEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKISP-FEHQTYCQR 80

plant   176 ILREIKLLRLLRHPDIVEIKHVMLPPSRREFRDIYVVFELMESDLHQVIKANDDLTPEHYQFFLY 240
            .||||.:|...:|.:|::|:.::...|..:.||:|:|..|||:||::::| ...|:.:|..:|||
  Fly    81 TLREITILTRFKHENIIDIRDILRVDSIDQMRDVYIVQCLMETDLYKLLK-TQRLSNDHICYFLY 144

plant   241 QLLRGLKFIHTANVFHRDLKPKNILANSDCKLKICDFGLARVSFNDAPSAIFWTDYVATRWYRAP 305
            |:|||||:||:|||.||||||.|:|.|..|.||||||||||::..:.....|.|:||||||||||
  Fly   145 QILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAP 209

plant   306 ELCGSFFSK-YTPAIDIWSIGCIFAEMLTGKPLFPGKNVVHQLDIMTDLLGTPPPEAIARIRNEK 369
            |:  ...|| ||.:|||||:|||.||||:.:|:||||:.:.||:.:..:||:|..:.:..|.|||
  Fly   210 EI--MLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEK 272

plant   370 ARRYLGNMRRKPPVPFTHKFPHVDPLALRLLHRLLAFDPKDRPSAEEALADPY---FYGLANVDR 431
            ||.||.::..||.||:...||:.|.|||.||.::|.|:|..|...|||||.||   :|       
  Fly   273 ARNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYY------- 330

plant   432 EPSTQPIPKLEF--EFERRKITKEDVRELIYREILEY 466
            :|..:|:.::.|  ..|...|:::.::.||:.|.|::
  Fly   331 DPGDEPVAEVPFRINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MPK9NP_001327296.1 None
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 156/344 (45%)
S_TKc 38..326 CDD:214567 144/291 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 1 1.000 - - FOG0000164
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.