DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SKOR and anox

DIOPT Version :9

Sequence 1:NP_186934.1 Gene:SKOR / 821052 AraportID:AT3G02850 Length:828 Species:Arabidopsis thaliana
Sequence 2:NP_001027085.1 Gene:anox / 3771728 FlyBaseID:FBgn0064116 Length:243 Species:Drosophila melanogaster


Alignment Length:202 Identity:52/202 - (25%)
Similarity:85/202 - (42%) Gaps:34/202 - (16%)


- Green bases have known domain annotations that are detailed below.


plant   524 KESNVRIKQLESDITFHISKQEA--ELALKLNSAAFYGDLYQLKSLIRAGGDPNKTDYDGRSP-- 584
            ||.:..:.||::.     ||.:|  .|.....|||....:.:|:.|     .||..  ..|:|  
  Fly    48 KEQSPGLLQLQAK-----SKWQAWRNLGTMSQSAARQAYVQKLQEL-----QPNWR--SRRNPGW 100

plant   585 -LHLAASRGYEDITLYLIQESVDVNIKDKLGSTPLLEAIKNGN-DRVAALLVKEGATLNIENAGT 647
             :|...|...||       :.:|       ....|.:.:|..| ||:..||.........|:...
  Fly   101 VVHSIESVPLED-------QRLD-------SEKTLFDHVKENNLDRLRELLQPSDLVKLDEHGMA 151

plant   648 FLCTVVAKGDSDFLKRLLSNGIDPNSKDYDHRTPLHVAASEGFYVLAIQ-LVEASANVLAKDRWG 711
            .:.....:...:.::.|:.:|...|.:|.:.:||||.|||.| ::.|:| |:|..|::..:|..|
  Fly   152 LIHWATDRNAVEIIQFLVRSGASVNQRDAEQQTPLHYAASCG-HLEALQCLLELHASLELRDSDG 215

plant   712 NTPLDEA 718
            .|..|.|
  Fly   216 QTCYDVA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SKORNP_186934.1 PLN03192 70..827 CDD:215625 52/202 (26%)
ANK repeat 580..611 CDD:293786 7/33 (21%)
ANK repeat 613..644 CDD:293786 7/31 (23%)
ANK repeat 677..708 CDD:293786 13/31 (42%)
anoxNP_001027085.1 ACBP 10..90 CDD:279259 13/51 (25%)
ANK 125..231 CDD:238125 29/99 (29%)
Ank_2 125..212 CDD:289560 24/87 (28%)
ANK repeat 148..179 CDD:293786 3/30 (10%)
ANK repeat 181..212 CDD:293786 13/31 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.