DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPF1 and e(y)3

DIOPT Version :10

Sequence 1:XP_006723470.1 Gene:DPF1 / 8193 HGNCID:20225 Length:398 Species:Homo sapiens
Sequence 2:NP_001259719.1 Gene:e(y)3 / 32965 FlyBaseID:FBgn0087008 Length:2012 Species:Drosophila melanogaster


Alignment Length:111 Identity:42/111 - (37%)
Similarity:54/111 - (48%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


Human   275 CDFCLGGSKKTG--CPEDLISCADCGRSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSEN 337
            |..||....:..  .||..|.|..|.:..||||:.....|...||.|.|||..||.|..|.:|:.
  Fly  1701 CGVCLRSQHRNARDMPEAFIRCYTCRKRVHPSCVDMPPRMVGRVRNYNWQCAGCKCCIKCRSSQR 1765

Human   338 DGASWAGLTPQDQLLFCDDCDRGYHMYCLSPPMAEPPEGSWSCHLC 383
            .|          ::|:|:.||||||:|||.  :...|:|.|||..|
  Fly  1766 PG----------KMLYCEQCDRGYHIYCLG--LRTVPDGRWSCERC 1799

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPF1XP_006723470.1 DPF1-3_N 13..79 CDD:464074
SFP1 <186..220 CDD:227516
PHD1_DPF1 270..327 CDD:277160 19/53 (36%)
PHD2_d4 328..383 CDD:277005 20/54 (37%)
e(y)3NP_001259719.1 WH_NTD_PHF10 1325..1418 CDD:411035
PHD_SF 1700..1754 CDD:473978 19/52 (37%)
RanBP2-type Zn finger 1700..1725 CDD:275375 7/23 (30%)
RanBP2-type Zn finger 1749..1775 CDD:275375 11/35 (31%)
PHD2_PHF10 1756..1799 CDD:277004 20/54 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.